Pages
- Best Laptops Deals February 2026
- Best Smart Watches February 2026
- Mobiles
- Amazon Deals & Offers for February 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 3rd February 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Khadi Omorose Bhringraj Hair Oil |Controls Hair Fall | Promotes Healthy Hair Growth | Mineral Oil Free | Makes Hair Strong, 210ml
- Khadi Omorose Onion Black Seed Hair Oil, Controls Hair Fall,Fights Dandruff – Makes hair Stronger & Shiny 100 Ml
- Emami 7 Oils in One Hair Oil | Makes Hair 20x Stronger and Manageable | Coconut Oil, Amla, Jojoba, Olive, Walnut, Argan & Almond Oils | 500 ML
- Sugar Tipsy Lips Moisturizing Balm 4.5 g- 06 Mango Margarita
- Surf Excel Matic Front Load Liquid Detergent 3 L|| Specially designed for Tough Stain Removal on Laundry in Washing Machines – Super Saver Offer Pack
- United Colors of Benetton Signature Analog Watch for Man with Blue Round Dial & Blue Stainless Steel Bracelet Band Water Resistant Men’s Wrist Watches – UWUCG1800
- Go Vegan Flax Seeds 250g – Fibre Rich Alsi Seeds, Raw Flax Seeds
- Samsung 1.5 Ton 5 Star AI Inverter Smart Split AC (WiFi, Energy Saving, Voice Control, Powerful Cooling, Copper, Digital Inverter, 4 Way swing, 5 Step Convertible, BESPOKE AI AR50F19D1NHNNA)
- Kuber Industries Set Of 2 Embroidered Purse Clutches
- Baidyanath Bhringrajasava 450 ml Syrup |Made with Natural Ayurvedic Ingredients for Hair, Liver, Cough Health and Blood Purifier
- Baidyanath Mahabhringraj Oil | Ayurvedic Hair Oil – 200 Ml + Free Hair Root Comb
- 41 foods Dry fruits combo pack of Californian Almonds Walnuts | badam akhrot 300 GM Walnuts, Almonds (2 x 150 g)
- ZEBRONICS Wireless Mouse, 2.4GHz, 3200 DPI, 3 Buttons, Comfortable & Ergonomic, USB Nano Receiver, Power-Saving Mode, Works on Most Surfaces, for Mac | Laptop | Computer (Freego, Black)
- Havells Grey 1000 Watt Immersion Heater
- stanfresh Shandar Safai Combo Bucket
- Gear Men/Women Voyager 15 Litre Small Casual Standard 2 Compartment Backpack/Daypack/Hiking Daypack/Drawstring Bag (Black-Yellow), Multicolor
- Fiama Men Gel Bar Active Celebration Pack with 3 Unique Gel Bars, 375g (125g – Pack of 3),Charcoal and Grapefruit, Refreshing Pulse and Energising Sport for Moisturised Skin, Soap for Men, For All Skin Types
- Santoor PureGlo Glycerine Soap with Almond Oil and Glycerine, 125g (Pack of 6) for Nourished Glowing Skin
- Tide Matic Liquid Detergent 2L Top Load Washing Machine
- POND’S Youthful Miracle Hexyl Retinol Complex, Renew & Repair Day Cream 50g SPF 15 PA++
- Crompton Emergency 9 W LED Bulb Base B22 Cool Day Light (Pack of 2)
- Campus Men Plush Running Shoes
- CG-Magnamix 25 Ltr Storage Water Heater (Geyser) | 5 Star Rated | High Rise Compatible | Glasslined Tank | Copper Element | Rust Proof Body | 100% Copper Element | 2 Yrs Product & 5 Yrs Tank Warranty
- Havells 13 Fin Oil Filled Room Heater (OFR) | Advanced New U-Tech Fast Heating Fins with 10-Year Warranty | 2900W | ISI Approved | PTC Fan Heater | Inclined Control Panel | Black
- Cello Kleeno by Cello Ex- Sponge Pad,1pc, White
- Parachute Advansed Cocoa Repair Body Lotion, Intense Moisture, 600ml
- Wild Stone Red Deodorant Body Spray for Men, 225ml
- Fitness Mantra® Sports Winters Cap & Muffler for Men & Women| Beanie Cap| 1 Set| (Black)
- Kobo WTG-17 Professional Ladies/Girls Gym Gloves for Fitness/Functional Training Hand Protector (Medium)
- LG 8 Kg 5 Star Smart Inverter Technology Fully Automatic Top Load Washing Machine (T80VBMB4Z, Turbodrum, Auto Prewash, Stainless Steel drum, LED Display, Smart Diagnosis, Middle Black)
- Samsung 8 kg, 5 star, Eco Bubble Tech, Digital Inverter Motor, Soft Closing Door, Fully-Automatic Top Load Washing Machine (WA80BG4441BGTL, Light Gray)
- Puma Men Armour V2 Sneaker
- Bajaj 20 Watt LED Batten with Glare Free Lighting (Pack of 4, white)
- Up to 80% off on Locomotive Clothing
- Sebamed Baby Cleansing Bar – 100 g
- EcoLink Elite 5W Round LED Ceiling Downlighter (Cool Day Light,Pack of 1)
- Eastman 9 Pcs Allen Key Set Chrome Vanadium Steel Metric Hex Wrench 1.5mm to 10mm L-Shape Professional Hand Tool EAK-2406
- Voltas Aqua Prime 25L Water Heater 2000W, Warranty of 7 years on Tank, 3 Years on Heating Element, 2 Years on Product by Voltas|Free Installation| Free Connecting Pipe|Copper Element|8 Bar (White)
- ATTRO Tasty Bite 3 Compartment Lunch Box with Small Container & Spoon BPA Free Food Grade Leak-Proof Microwave Safe Ideal for Kids-1020ml+70ml Green, Plastic
- Lacto Calamine Ubtan Face Wash for Glowing Skin | Natural Face Wash with Sandalwood, Saffron, Neem, Almond & Turmeric |Exfoliating Facewash reduces Tan | Sulphate, Paraben Free | 100 ml Pack of 3
- Carrot – Silicone Stretch Lids, Multi Size Reusable Silicone Lids Food And Bowl Covers, Dishwasher And Freezer Safe (Color May Vary) (Pack Of 6 Pcs), 10x10x2 Cm
- Gulabari White Rose Soap – 450g (150g x 3) | Moisturizing Bathing Soap for Soft, Glowing Skin for Skin & Body | Goodness of Almond Milk, Honey & Niacinamide
- MarwarBites Mix Dry Fruit 900GM | Healthy Mixed Nuts and Seed with Almonds, Cashews, Dates, Pumpkin Seeds, Candied Amla | Reusable Jar Pack
- Lifelong Set of 6 Home Decor for Living Room & Balcony | 6 Inch Flower Pot | Decorative Indoor & Outdoor for Plants | Gamla, Pot Stand for Home & Garden Decoration | Ideal for Small Plants
- 100% Waterproof Premium Terry Cotton Mattress Protector | Breathable and Hypoallergenic Ultra Soft Fitted Bed Protector 36×72 inch-Single, Color-Grey
- Green Soul Alba 7 Shelves Engineered Wood Book Shelf | Multipurpose Wooden Bookshelf for Home, Bedroom, Living Room, Study Room, Kids Room | Organizer | Storage | 3 Year Warranty (Frosty White)
- Wonderchef Taurus Hard Anodized Outer Lid Pressure cooker, 3 liter, Cool Touch Handles for Durability, Induction Friendly, Black, 5 year warranty, ISI Certified
- Pampers Premium Care Diaper | Pant Style Baby Diapers Double Extra Large Size, 90 Count | Anti Rash Diaper with Aloe Vera and 100% Leak Proof Protection | (90 Count)
- Fitness Mantra® Weight Adjustable Hight Quality Hand Gripper for Men & Women |Hand Grip|Finger Exerciser|Power Gripper|Hand Exerciser Equipment|Hand Strengtheners|Black| 10KG-60KG|,Polypropylene
- SET WET Deodorant Spray Perfume Cool, Charm & Swag Avatar for men, 150ml (Pack of 3)
- CP PLUS 2.4MP Full HD IP Indoor Wired Dome Camera CP-URC-DC24PL3 Compatible with DVR only | 30 Meters IR Black & White Night Vision | 3.6mm Lens | Motion Detection, White
- PEARLPET BPA-free Plastic Water Bottle Set of 6 Pcs, Each 1000ml, Purple
- HAMMER Type C to Type C Cable 65W Braided, PD Fast Charging, Data Sync, 1.5 Meter Tangle Free Wire, Compatible with all C-Type Enabled Devices (Blue)
- Orient Electric Areva Portable Room Heater | 2000W | Two Heating Modes | Advanced Overheat Protection | Horizontal & Vertical Mount | 1-year replacement warranty by Orient | White
- Dabur Gluco Plus C Lemon – 1 Kg
- Safewash Top Load Matic Premium Liquid Detergent 2L Refill Pouch with Colour-Protect Technology | 2x Stain Removal | For All Types of Fabrics
- tu casa Off White Cotton Shade with Black Metal-Iron Base Table Lamp | Elegant Bedside & Desk Lamp for Bedroom, Living Room, Office, Home Décor & Gifting (Height : 22 Inch/No Blub Included)
- Savlon Herbal Sensitive Germ Protection Liquid Handwash Refill Pouch, 1.3L ph Balanced
- Larah by Borosil 700 ml Cube Blue Stainless Steel Water Bottle | Made in India Pu Insulated Thermoware | Leakproof, BPA Free| Bottle for Office, School, College & Gym, Daily Use | 1 Year Warranty
- Shalimar Reusable Hand Gloves (Pack Of 1/200 Pieces) For Gardening, Kitchen Cleaning And Dishwashing (Natural Colour) – Free Size
- Philips 12 Watt Black Reflector LED Ceiling COB Round Spot Light with Focused Beam | Cut Out: 102mm | Warm White, Pack of 2 (Deco Bright)
- CELLO Aqua Sparkle Bottle Set of 3, 1000ml, Blue | 100% food grade | Leak proof and Break proof | Perfect for staying hydrated at the school, college, work and outdoor adventures Water Bottle
- Presto! Dishwash Gel Refill Pouch | Lemon | 2 Litre | Leaves No Residue And Foul Smell | Grease Cleaner For All Utensils
- Portronics 35W Adapto 35B Dual Port Fast Charging Adaptor with Type C PD Port & USB-A Port, LED Indicator, PPS Technology, 18W USB Output, Supports iPhone, Samsung & Other Android Devices(White)
- Portronics Adapto 12 2.4A 12W Fast Wall Charger for iPhone 11/Xs/XS Max/XR/X/8/7/6/Plus, iPad Pro/Air 2/Mini 3/Mini 4, Samsung S4/S5, and More(White)
- pTron Bassbuds Indie in-Ear TWS Earbuds w/ 10mm Drivers, 45Hrs Playtime, Dual HD Mic & AI-ENC Calls, Custom EQ, Mobile App, Bluetooth V5.4 Earphones, Voice Assistant, Type C Charging & IPX5 (Gray)
- LONGWAY Creta P1 600 mm/24 inch Ultra High Speed 4 Blade Anti-Dust Decorative Star Rated Ceiling Fan (Smoked Brown, Pack of 1)
- Wonderchef Acura Stainless-steel Electric Kettle | 1.5 L | Auto Shut-off | 360 Degree Swivel Base | Thermostat Control | Power Indicator | 1-year Warranty
- amazon basics 2-in-1 Type-C and Micro USB Braided Cable | 3A/18W Fast Charging & 480 Mbps Data Transfer | 1.2m, Tangle Free Cable
- Portronics Mport 8 USB-C USB Hub/Docking Station(8-in-1) with 4K 30Hz HDMI, 100 Mbps Ethernet, USB 3.0, microSD/SD Card Reader, Type-C Data, PD Charging, USB 2.0, Type-C Plug for Laptop, Mac, PC
- Halonix Astron Plus Base E27 7-Watt LED Bulb (Warm White)
- Axe Signature Intense Long Lasting No Gas Deodorant Bodyspray Perfume for Men 154 ml
- Bajaj Softlite LED Multi-CCT 3 in 1 Color Modes Table Lamp | 360 Degree Rotating Head | Feather Touch Operation | 1 Year – Warranty | Upto 4 Hours Backup Time (Pack of 1, White)
- amazon basics RJ45 Cat-6 Ethernet Cable Patch/Lan Cable For Smartphone, Router, Printer -25 Feet (Black)
- BSB HOME Snuggle Up 2.O Monsoon/All Season Solid Reversible Double Bed Microfiber Comforter Blanket | Quilt | Dohar | Rajaai | Duvets – (220 GSM, Light Green)
- Lifelong Table Tennis Balls | 40mm 3 Star ABS Plastic | Professional Ping Pong Balls for Kids and Adults | for Training and Practice, Indoor Outdoor Games and Matches | Pack of 6
- Dabur Gulabari Shower Gel – 500 ml | 99% Pure Glycerine | Gentle Bodywash | Himalayan Rose Extract to nourish and revitalise the skin | 0% Parabens & Soap | No Silicones | With Oudh Fragrance
- JIVO Cold Pressed Kachi Ghani Chemical Free Mustard Daily Cooking Oil, 1 Litre | Recommended for Roasting, Frying, Baking All type of Cuisines |
- L’Oreal Paris Glycolic Bright Glowing Serum 30ml
- Sunfeast Glucose Plus, 1 Kg
- Amazon Brand- Solimo Indoor and Outdoor Round 10 Inch Flower Planter Pot Best for Terrace/Balcony/Home/Office Decor – Set of 2
- Lifelong Kitchen Organizer Stainless Steel Drying Rack -Vessel,Dish,Utensil Drainer Basket with Drip Tray, Suitable for All Utensils, Crockery, Plates & Bowl with Spoon Holder -Over Sink Bartan Stand
- Dabur Red Bae Fresh Gel – 600gm (300gm*2) | Fights Bad Breath, Cavity Germs and Plaque | 12hr Freshness | Activ Germ-Kill formula
- Sunfeast Dark Fantasy Choco Fills, 460g Original Filled Cookies with Choco Crème | Perfect Snack
- Cinthol Original Bath Soap 99.9% Germ Protection, 100G (Pack Of 4)
- Homesake® 6 Watt, 3 in 1 Multicolor Led Bulb, Cool White, Warm White, Neutral White LED Bulb, E27,
- Gear Triumph Floral 32 L Water Resistant 3 Compartment Backpack with Rain Cover/School Bag/College Bag/Daypack/Casual Backack for Girls/Women (Yellow-Teal)
- HyperX Cloud Mini Wired in Ear Headset Compatible with PC,Chromebook,Nintendo Switch,PlayStation Controllers,Xbox Controllers,Phones,Laptops,Tablets,Tuck-Away Boom Mic,3.5mm Jack,Multi Color
- Portronics Adapto 66 2.4A 12w Dual USB Port 5V/2.4A Wall Charger,Comes with 1M Micro USB Cable, USB Wall Charger Adapter for iPhone 11/Xs/XS Max/XR/X/8/7/6/Plus(White)
- Parachute Advansed Jasmine Gold Coconut Hair Oil With Vitamin-E For Super Shiny Hair, Non-sticky, 500ml
- MasterChow Healthy Whole Wheat Noodles- Pack of 2 | 100% Atta | No Maida, Not Fried | Serves 10 Meals – 600gms
- Halonix 11W Emergency Inverter Bulb | Rechargeable Emergency B22D Led Bulb For Power Cuts | Backup : Upto 4Hrs | Cool Day Light | Pack Of 2 | Rechargeable Emergency Light
- Dove Intense Repair Conditioner 335 ml|| With Keratin Actives to Smoothen Dry and Frizzy Hair – Deep Conditions Damaged Hair for Men & Women
- Close Up Toothpaste | Long lasting 18 Hours Of Fresh Breath & White Teeth – 600g (Pack of 4)
- amazon basics TWS in-Ear Earbuds (AB-T17) with Fast Charging up to 70 Hours of Playtime | Dual 13mm Driver | IPX4 Water-Resistance | Bluetooth 5.3 | Charging Case with Mic | Touch Control (Blue)
- Fire-Boltt Aero TWS Earbuds Custom EQ, Wireless Bluetooth 5.4, Music & App Support, 50H Playtime, Fast Charging Case, 50ms Low Latency for Gaming, Touch Controls, IPX4 Waterproof, Clear Calls – Black
- MS Self Adhesive Bathroom Shelf I Wall Mounted Bathroom Organizer I Shower Caddy Shelf Organizer Rack I Multifunctional Bathroom Rack for Bathroom, Living Room & Kitchen Accessories, Pack of 2
- Fiama Gel Bar Soap Blackcurrant And Bearberry 625g (125gx5) For Radiant Glowing Skin, With Skin Conditioners, All Skin Types, For Women & Men
- 2 in 1 Puzzles for Toddlers | Educational Board Game ABCD,Alphabet Board for Kids 1-3+ Years | ABCD Puzzle with Removable Letters and Picture Flags | Early Education Gift for Kids
- Multi-Layer Expanding Folder 13 Layer A4 Paper File Folder, Student Data Sorting Paper Storage Bag, Portable Vertical Organ Bag (1Pcs) (Multiolor)
- PRAKASAM COTTON Mens Cotton Single Colour Casual Style Thalapathi Border Dhoties For Mens/Fine Quality Single Dhoties For Men’s
- Milton Pro Cook Kitchen Pride Non-Stick Cookware Set of 5 | Includes Nonstick Tawa, Frying Pan, Kadhai with Lid, Nylon Laddle & Spatula | Non-Induction Base | Peach Color
- RR Signature Triana 1200MM 2 Star BEE Certified Energy Efficient 50-Watt High-Speed Ceiling Fan For Home and Office (Lavender)
- Philips 10 w LED Bulb|3 Colors in 1 LED Bulb|Scene Switch Bulb for Home & Decoration|Color: Tunable White, Pack of 4, b22d
- HP 360 Mono Portable Silver Bluetooth Speaker with Built-in Microphone Ip54 Dust and Water Resistance (2D801AA)
- The Earth Store 1000 ML Plastic Oil Dispenser Set of 2 Transparent Cooking Oil Pourer for Kitchen Leakproof Sauce Vinegar Liquid Dispenser
- One Plus Fast 80W Original USB Type C Data Sync Fast Charging Charger Cable for One Plus 13,13s,13r,12,12r,11,11r,10,10r,10t,10pro,9,9rt,9r,9pro,8,8t,7t,7pro,Nord 5,CE5,CE4,CE3,CE2lite,4,3,2,2T
- BSB HOME Premium Super Soft Cloudy Printed Mink Single Bed Blanket for Mild Winter/Heavy Winter, Ultrasoft & Cozy Single Ply Blanket | | 152 x 228 Cm (Brown & Pink Rose Printed, Weight 1100 Grams)
- Deconstruct Brightening Tinted with SPF 50 | For Dark, Pigmented, Dry, Flaky Lip | SPF 50 for Sun Damage and Discoloration | Lip Balm for Glossy Buttery Soft Pink Lips | For Women & Men – (4.2g)
- Attro Lenova Utensil Basket-Stylish and Durable Plastic Kitchen Organizer Rack Cutlery Utensil,Simple Assembly, Fruits and Vegetable Drying Drain and Storage Stand with Water Storing Tray-Brown
- Portronics Konnect X USB to 8 Pin Cable with 3A Output, Fast Charging & Data Transfer, Nylon Braided, Aluminium Alloy Shell, 1M Length compatible with 8 PIN Devices(White)
- Beardo Everyday Essential Combo for Men- LSD ,Whisky Smoke Firebomb, Mariner & Legend Perfume for Men (20ml x 4) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Pampers Complete Skin Comfort Pants Style Baby Diapers, XXX-Large (XXXL) Size, 22 Count, Anti Rash Blanket, Lotion with Aloe Vera, 16-30 kg
- Santoor Beauty Talc with Sandalwood Extracts| Sandal, Rose, Musk & Geranium Mint Fragrance| Absorbs Excess Moisture| Dermatologically Tested| For All Skin Types (400g)
- Beardo Twin Legends- LSD & Legend Perfume for Men (20ml x 2) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Cello Kidzbee Era Best Pals Inner Steel Insulated Kids Water Bottle, 400 ml, Light Blue | Leakproof Easy to Open Flip Top Cap with Inner Straw | Hot & Cold Water Bottle For Kids School, Picnic, Travel
- Borosil Elite Universal Lunchbox | Set of 4 (320ml x 2 Square + 240ml x 2 Round), Borosilicate Glass | Microwave & Dishwasher Safe, Leakproof | Tiffin for Office/School/College
- STRIFF Laptop Tabletop Stand, Adjustable Laptop Computer Stand, Multi-Angle, Portable Foldable Laptop Riser Notebook Holder Compatible for 9 to 15.6 Laptops (Black)
- Solimo Plastic Storage Jar and Container Set I Air Tight & BPA Free Containers for Kitchen Storage Set I Grocery Kitchen Container Set I Multipurpose Jar, 500 Ml Each, Set 12, Red
- GOVO GOSURROUND 950 | 500W Sound bar | 5.1 Channel Home Theatre with 6.5″ subwoofer | Dual Rear Satellites, HDMI, AUX, USB & Bluetooth, 5 Equalizer Modes, Stylish Remote & LED Display (Platinum Black)
- Wonderchef Black Stainless-Steel Electric Kettle – 1.5 L
- Cello Transparent Set Of 3 Glass Microwave Safe Lunch Box
- Bajaj Red Celesta LED Rope String Light 120 L 5 m
- Havells Chimes G95 Clear 2w Light Bulb
- Amazon Basics Leather Laptop Backpack (15.6 Inch) | Water Resistant | Large Storage Compartments | Breathable Shoulder Straps | for Office, Travel or College (Black)
- FASHION COLOUR Teracotta Eyeshadow | Pigmented | Lightweight | Blendable | Comfortable | Blendable | Lightweight | Available in Fab shades | Shade 08
- HIMANSHI HERBALS Yellow Dry Dates | Sweet & Chewy | Ideal for Healthy Diet | Natural Sweetness Dates (1 x 1000 g)
- INALSA Oven Toaster Griller 10 L, Cake Baking Oven OTG Multi-Task with Temperature 800 Watts, Includes Baking Pan, Grill Tray & Tray Handle (Black/Silver), kitchen,2 Year Warranty
- American Tourister Polyester Harp Duffle Bag 52 Cm Grey, Duffel Bag for Travel, Gym Bag for Men, Women, Durable with Strong Zips, Overnighter
- Lenovo Yoga Slim 7 (Smartchoice) Aura Edition, Intel Core Ultra 5 226V, 16GB RAM, 1TB SSD, WUXGA OLED, Copilot+ AI PC, 40 TOPS, 14″/35.5cm, Windows 11, Office 2024, Grey, 1.19Kg, 83JX005FIN, AI Laptop
- Titan Neo XI Analog Watch – For Women 2648SM14
- Titan Neo XI Analog Watch – For Women 2648WM12
- U.S. Polo Assn. Men Colourblocked Sneakers
- Boat Airdopes 131 Pro Buds TWS Earbuds (Active Black)
- Caprese Tira Medium Sling Bag for Women with Adjustable & Detachable Strap for Comfortable Wear | Magnetic Button Closure | Versatile Handbag for Everyday Use, Travel, & Special Occasions
- GOBOULT (formerly Boult) Bluetooth & Wired (Powder Blue, On the Ear)
- Storio Baby Stroller/Pram for Newborn to 3 Years | 5-Point Safety Harness | Adjustable Backrest | Reversible Handle | 360° Swivel Wheels | Comfortable & Foldable Pram (Navy Blue)
- Dermi Cool Menthol Regular Prickly Heat Powder 400g
- BOMBAY SHAVING COMPANY Fresh Aqua & Intense Musk 120mlx4 Combo Deodorant Luxury Long Lasting Fragrance Deodorant Spray – For Men & Women (480 ml, Pack of 4)
- DOVE Men+Care, with Vitamin B3, Hydration Boost Moisturizer, for refreshed hydrated Skin, long lasting hydration, 100gm
- HyperX Pulsefire Core RGB USB Gaming Mouse, Software Controlled RGB Light Effects & Macro Customization, Pixart 3327 Sensor up to 6,200DPI, 7 Programmable Buttons- Black, 87gm (4P4F8AA)
- RR Signature Centaur 400 MM Table Fan For Home & Office|90 Degree Silent Oscillation | High Air Delivery | 3 Speed Setting | 2 Year Warranty 【White-Blue】
- Upto 80% Off On Clarks Footwears.
- Aldo Women @ 70% off
- Crompton Laser Ray Neo 3-in-1 20 W Batten (Pack of 1)
- Pigment Play Eyeshadow Palette, For Women, X Emoji, Ultra pigmented and easy to blend formula, 9 gm (Wassup Panda?, 9gm)
- Roasty Tasty Bajra Chikki | Millet Chikki Bars | Peanut Chikki with Jaggery | Protein Snacks | No Added Sugar | Healthy Snacks | Energy Bar Replacement | Gluten Free | Pack of 2 | 20 Pcs | 15g each
- Carrier 1.5 Ton 3 Star Flexicool Inverter Split AC (Copper, Convertible 6-in-1 with Smart Energy Display, Insta Cool, Auto Clean, PM 2.5 Filter, 2026 Model, ESTER EDGE Gxi-CAI18EE3R36F0, White)
- Giftana Home Sweet Home Wood Keychain for Men and Women, New House Keyring, Housewarming Gifts Key Chain Real Estate Gifts Buying and Selling Keychain (Beige)
- Ganesh Quick Carry 1 Layer Portable Insulated Food Container Airtight Leak-Proof Lunch Box for Office, School, Picnic (400ml) Brown
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Achanta Sharath Kamal represents India in which sport?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Amazon FunZone Quiz Answers Today – 3rd February 2026
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- National Rifle Association of India is associated with which sport?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Ligue 1 is the top national league in which country?
- Who became the first Indian woman to score 50 international goals in 2024?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- In 2024, who became the youngest person to win two Oscars?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- Which director won his first directing Oscar in 2024?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Who became the 17th Indian to score a century in Test debut?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- The iconic Air India building at Nariman Point was handed over to which state government?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 3rd February 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Amazon FZ Runs Daily Quiz Answers 3rd February 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato