Pages
- Best Laptops Deals April 2026
- Best Smart Watches April 2026
- Mobiles
- Amazon Deals & Offers for April 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 6th April 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Portia Lap Desk Pillow (68 x 58 Cms) – Portable Laptop Table for Bed, Sofa, or Floor | Ergonomic Design with Armrests for Gaming, Reading, Studying & Working (Grey)
- Dabur Vatika Ayurvedic Shampoo – 1L & Dabur Amla Hair Oil – 180 ml
- OYO BABY Ultra-Soft Baby Swaddle Wrap Blanket with Hood & Booties – Warm Fleece Sleeping Bag for Newborns (0–6 Months 72 * 68 cm) – Star Print, Dark Blue
- SOFTSPUN Microfiber Cleaning Cloths, 12pcs 30x30cms 220 GSM Multi-Colour! Highly Absorbent Lint and Streak Free Multi -Purpose Wash Cloth for Kitchen Window Stainless Steel Silverware.
- Dove Serum Bar | with Radiance Serum | Pink Radiance | 625g (125g x 5)
- Amazon Basics MultiPro ZigZag Toothbrush for Adults, Multicolour | 12-Count (4 × 3 Packs) | Soft Bristles for Deep Cleaning, Plaque Removal & Gentle Gum Care
- iPhone Charger Adapter 20W Type C (MFi-Certified) for iPhone 17/17 Air/17 Pro/17 Pro Max,16/16 Plus/Pro/Pro Max, 15/14/13/12/11 Series with PD 3.0 USB-C Fast Charging Adaptor BIS Certified
- MamyPoko Pants Extra Absorb Baby Diapers, Medium (M size), 7-12 kg, 28 Count, Deep Sleep Diapers, Soft gentle fit, Deep Absorbent Crisscross, skin friendly with coconut oil
- Fitness Mantra® 12 Pairs Sports Ankle Cotton Socks | Free Size| Breathable| Daily Use| Multicolor| 12 Pairs|
- Washing Machine Cleaner Tablets 12 Pack | Deep Cleaning, Deodorizing & Descaling |For Front&Top Load Washers | Removes Odor, Residue & Buildup |Clean Inside Drum And Laundry Tub Seal.(12-PACK)
- Leader Beast 26T Multispeed (7 Speed) Mountain Bike with Front Suspension & Dual Disc Brake – MATT_Black_SEA Green, Ideal for 12 + Years,Mountain Bike,Mens,Front,18 inches
- Corslet 12 Shades Acrylic Markers Paint Pens Set Markers Ideal for Mandala Art Doodling Drawing Sketching, Colouring & Shading Pens for Painting
- Huggies Complete Comfort Wonder Pants | Pant Style Baby Diapers Small Size (S), 172 Count | India’s Fastest Absorbing Diaper, Prevents Diaper Rash, Ideal for 4 to 8 Kgs (86 Count, Pack of 2)
- Pampers Complete Skin Comfort Pants, Anti-Rash Blanket, Lotion with Vitamin E & Aloe Vera, New Born, Extra Small Size Baby Diapers (NB,XS) 86 Count, Upto 5kg
- Baidyanath Asli Ayurved Shikakai and Bhringraj Nourishing Shampoo I Hair Strong Shampoo I Coconut Oil I 200 ML
- Ambrane Type-C to Lightning USB Cable, 22.5W Fast Charging, 480Mbps Data Sync Cable Compatible with iPhone, iPad, Macbook, iMac, AirPods, 1.25m (ABTL-125 Black)
- Auravita Premium Chia Seeds 500 Gram | Rich in Calcium, Protein & Fibre | 100% Clean Chia Seeds for Eating | Antioxidant Rich Superfood for Smoothies, Salads & Baking
- IMECO ECO JAR Borosilicate Glass Sipper with Bamboo Lid & Straw, 500ml | Leak-Proof, BPA-Free & Eco-Friendly | Travel-Ready Bottle for Milk, Coffee, Green Tea & Water
- Mother Sparsh Natural Vapour Complete Cold Relief Roll-On for Babies-15ml | With Thymol Crystal, Eucalyptus Oil & Peppermint Oil for Cold & Cough | 100% Natural | Relieves Chest Congestion
- Boldfit Orthopedic Knee Caps for Pain Relief Bamboo Yarn Knee Support Sleeves Brace for Sports, Compression Support, Exercise, Gym, Running, Cycling, Knee Guard for Men & Women – M
- Fiama Body Wash Shower Gel Patchouli & Macadamia, 250ml, Body Wash for Women & Men with Skin Conditioners For Soft, Glowing Skin, Suitable for All Skin Types
- RORIAN Electric Portable Digital Hanging Scale – 110lb/50kg High Precision Portable Hook Scale with Backlit LCD for Travel and Home – Multi-Purpose Use (Black S1) (3 Months Warranty)
- Bosch 226 L, 4 Star, Single Door Refrigerator with Industry’s largest vegetable box & largest Beverage space (CST22S24NI, Fine Steel) | 18 Hour Cooling Retention during powercut, 2.5x Faster Cooling
- Samsung 34″(86.42cm) Odyssey G5 Curved Gaming Monitor|WQHD 3440 x 1440|1000R|165Hz|1ms|21:9|Wall Mountable|FreeSync Premium|Ports-DP, HDMI, Headphone|DP Cable|Eye-Saver|LC34G55TWWWXXL|Black
- Samsung 189 cm (75 inches) Crystal 4K Ultra HD Smart LED TV UA75UE85AFULXL (Black)
- Dimpy Stuff Dino Plush Toy – Purple 23 cm (9″) – Super Soft Squishy Nursery Decor Children
- Medimix Ayurvedic Anti Pollution Facewash, 100 ml
- Rexona for Female Shower Fresh Underarm Roll On Deodorant + Antiperspirant With Glycerine, Removes Odour, Even Skin Tone,Keeps Skin Fresh & Clean, Alcohol Free, 50 Ml (Pack Of 2)
- Wild Stone Perfume Gift Set for Men 2x20ml | Eau De Parfums | Premium Gift Set for Men | Ultra Sensual & Edge Perfume for Men | Long Lasting Luxury Fragrance
- RR Signature WINCHILL CH Personal Air Cooler 50 LTR 【Dark Grey】
- Bikano Bombay Mixture | Spicy & Tangy Indian Namkeen Snack | Crunchy Blend of Sev, Peanuts & Spices | Tea-Time Snack – 800g
- Kellogg’s Millet Muesli with 84% Fruit, Seed & Multigrain| Power Breakfast | No Maida No Palm Oil | India’s No 1 Muesli | 500g
- Patanjali Kesh Kanti Hair Cleanser Natural Shampoo, Herbal Care for Healthy Hair, Suitable for All Hair Types (650 Ml)
- Drontika Wild & Pure Activated Charcoal Bright Detox Face Wash Deep Cleansing & Brightening Formula for Clear, Radiant Skin 100ml.
- Goldmedal Vector 1200mm 1 Star Rated Ceiling Fan for Home And Office | High Grade Copper | Ultra High Speed (Honey Mist Colour)
- GO DESi Dates Dry Fruit Barfi – 200 grams | 93% Dry Fruits | No Added Sugar | Sweets | Burfi
- truke New Launch Aura Pro True Wireless in Ear Earbuds w/ 60H Battery & Fast Charge Ear Buds, 13mm Titanium Drivers, Dual Pairing, 4-Mic ENC TWS, 40ms Low Latency Gaming, Made in India -MidnightBlack
- RR Signature 1200 MM Wavia High Speed Ceiling Fan for Home & Office, 35% Energy Saving, Designer Ceiling Fan, 2 Year Warranty (Silky Silver)
- Cif Original Multipurpose Surface Cleaner Cream for Kitchen & Bathroom, Ocean Breeze Scent, 100% Dirt Removal with Natural Cleaning Particles, 500 ml
- Gleva Liquid Eyeliner Pen Eye Makeup Waterproof Smudge proof Longwearing, Slim Tapered Tip Super Slim Liquid Eyeliner Quick Drying Formula Glides on Smoothly (Middle Brown)
- Noise Buds N1 Truly Wireless Earbuds with Chrome Finish, 40H of Playtime, Quad Mic with ENC, Ultra Low Latency Gaming (Up to 40 Ms), Instacharge(10 Min=120 Min), Bluetooth V5.3(Ice Blue)
- Aqueria 5.5% AHA BHA French Underarm Brightening Roll On | 48H Odour Control | Flora Fragrance with 2% Niacinamide | Multi Actives, Glycolic Acid, Lactic Acid | Prevents Odor, Kills Bacteria | Exfoliates, Reduces Pigmentation & Discoloration for Even-Toned Underarms | Brightens Skin & Exfoliates Underarm | Alcohol & Aluminium Free | Deodorant for Men & Women | Pack of 2 (100ml)
- Dabur Vatika Ayurvedic Shampoo Refill Pouch – 1 L | Damage Therapy | Power of 10 Ingredients for Solving 10 Hair Problems | No Parabens | For All Hair Types
- Boroplus Antiseptic And Moisturising Bathing Soap With Aloe Vera, Neem And Tulsi | 99.9% Germ And Virus Protection | For Smooth, Soft & Nourished Skin, 125G (Pack Of 6)
- EcoLink 20w LED Batten/Tubelight | Champion Compact 4-ft LED Batten for Living Room & Bedroom | Cool White,Pack of 2
- Maybelline New York Smooth And Non-sticky Lifter Gloss – Topaz | Tinted Lip Gloss With Hyaluronic Acid for Hydrated & Plump Lips | Non-Sticky application | Long-lasting Fuller & Lifted Look | 5.4ml
- Mamypoko pants All night absorb| Pant Style Baby Diapers Small Size(S), 112 Count, Ideal for upto 5Kgs|1 Diaper= Upto All night Absorption|Wider Crisscross Sheet|Gentle Coco Care| 12hr Leakage Protection| Prevents Heaviness (Pack of 2)
- Bosch 226 L, 3 star, Direct-Cool Single Door Refrigerator | 18 Hrs Cooling Retention | 2.5X Faster Cooling | Spacious Multi Box | Delicate Crisper for Soft Veggies (2026 model, CST22U13AI, Dark Lake)
- boAt Stone Arc, 58mm Drivers, 12H Battery, RGB LEDs, Built-in Mic…more
- Pigeon By Stovekraft Swift Plus Multi-Cook Kettle 1.5L, With Steamer, Egg Rack – Blue | Double Layered | Food Grade Stainless Steel Inner Wall | Glass Lid | Auto Shut-Off, 600 Watts
- Nike Woman Deodorant Spray Pack of 3 – Honey, Oud & Musk Long Lasting Fragrance Body Spray for Women | 24H Freshness | 200ml Each
- NIVEA Fresh Comfort Deodorant, 150ml | 48 H Smooth & Beautiful Underarms| 0% Alcohol | For Women
- Solimo Premium Faux Leather Bean Bag Combo with Footrest & Cushion, Filled with Beans | Capacity: Upto 6 Ft 3 in Height, 120 KG Weight | 3XL | Globe Trotter | Black
- LONGWAY Creta P1 600 mm/24 inch Ultra High Speed 4 Blade Anti-Dust Decorative Star Rated Ceiling Fan 2 Years Warranty (Silver Blue, Pack of 1)
- HIMANSHI HERBALS Black Dry Dates 1kg | Naturally Sweet & Fresh | High in Iron & Fiber | Dry Fruit | Healthy Snack, No Added Sugar, Kali Khajoor
- Joy Even Tone Bright Radiance Brightening Summer Body Lotion 400ml | With Niacinamide & Alpha Arbutin | Removes Tan, Dark Spots & Restores Natural Glow | Lightweight, Non Sticky & Non Greasy
- Cetaphil Gentle Exfoliating SA Cleanser 29ml | Daily Foaming Face Wash with Salicylic Acid, Mandelic Acid & Gluconolactone | Smooth, Even Skin | For Sensitive & Acne-Prone Skin
- MILTON Pro Lunch Box with Steel Cutlery, 3 Microwave Safe Inner Steel Containers (180ml, 320ml, 450ml) Plastic Chutney Dabba 100ml, Bottle 750ml with Insulated Bag, Office Tiffin, Black
- amazon basics TWS in-Ear Earbuds (AB-T01A) with Fast Charging up to 50 Hours of Playtime | Dual 10mm Driver | IPX4 Water-Resistance | Bluetooth 5.3 | Charging Case with Mic | Touch Control (Mint)
- Presto! Bathroom Squeegee Plastic Wiper – 30 cm | Green
- Parachute Advansed Coconut & Aloe Vera Hair Cream 210ml | Nourishes and Hydrates Hair | 2X Shiner, Smoother, Softer Hair | Leave-in Hair Cream | Pre-Wash Hair Cream | For Men & Women
- Bombay Shaving Company OmniBlade 3-in-1 Beard and Body Trimmer For Men | Trim, Style, Shave | Type C Flash Charging | Multi Length Settings Comb, Detachable Blades | Gifts For Men
- JIVO Cold Pressed Kachi Ghani Chemical Free Mustard Daily Cooking Oil, 1 Litre | Recommended for Roasting, Frying, Baking All type of Cuisines |
- Havells FAB BLDC ULED Ceiling Fan 1200mm, 5 star, LED Speed Indicator, 380 RPM, Up to 65% Savings,Reverse Rotation,4 Speed Modes,Low Wattage 30W,Low Noise,Air Flow:225 CMM, 3 Year Warranty,Cocoa Brown
- F&D A521X 104 W Bluetooth Home Theatre (Black, 2.1 Channel)
- aqueria Sunscreen – SPF 50 PA++++ Oil Control Brightening Multi-A…more
- Gear Clubsport 3 9″/33L Faux Leather Large Water Resistant Duffle Bag/Travel Bag/Gym Bag for Men & Women(Brown-Tan)
- HAMMER Wave 10W Bluetooth Speaker Up to 8 Hours Playtime, TWS Function, Made in India, Built-in Mic, BTv5.4, USB Port, Type-C Interface Wireless Bluetooth Speaker with Hanging Loop (Blue)
- Eduway® Canvas Board for Painting- (4″x4″, 8″x8″, 8″x10″) 2 pcs each | Premium Quality 7Oz Pre-Primed Cotton Canvas Board for Artists & Beginners | Ideal for Acrylic, Oil, Gouache, Pastels Colors ( Pack of 6) (10×10,20×20, 20×25 cms).
- Skechers Men Bounder Mirkle Sneakers
- Santoor Refreshing Shower Gel With Natural Lemon & Frangipani Extracts| For Men & Women| For Soft and Fresh Skin| Suitable For All Skin Types| No Parabens| No Silicones| 500ml
- Set Of 3 Paintings
- Horlicks Chocolate Nutrition Drink || 1 kg Refill Pack
- Yardley London Gentleman Luxury Grooming Kit For Men With Classic Activated Charcoal Soap, Elegance Lather Shaving Cream, After Shave Lotion, Shaving Brush, And Classic Body Deodorant Spray
- Lifelong Cuppy Panda Ride On Swing Car for Kids Age 2+ Years | No Battery or Pedal | ABS Body | Twist & Go Steering | Non-Slip Wheels for Indoor & Outdoor | Easy to Carry | Push Car | Capacity 100 kg
- LOTUS HERBALS ACTIVE ALOE+NIACINAMIDE CALM NIGHT GEL (50 g)
- adidas Men’s Clinch-X M Running Shoe
- New Balance Mens 680 Sneaker
- U.S. POLO ASSN. Men’s I708 Comfort Stretch Activewear Underwear Briefs – Pack of 1
- U.S. Polo Assn. Mens Cotton Coolmax Solid I706 Briefs – Pack of 1
- U.S. Polo ASSN. Men’s I704 Ultra Soft Cotton Rich Premium Briefs – Pack of 1
- U.S. Polo Assn. Men Logo Waistband Cotton Stretch IYAH Briefs – Pack of 2
- U.S. Polo ASSN. Men’s I702 Modal Stretch Luxe Comfort Briefs – Pack of 1
- Boldfit Stainless Steel Protein Shaker Bottle 750ml with Glass Window, Leakproof Metal Shaker for Gym with Blender Ball, BPA-Free, Odor-Resistant, Heavy-Duty Mixer for Pre & Post Workout Supplements
- Himalaya Sunprotect + | Ultra-light Sunscreen Lotion | SPF 50 PA ++++ | 90% Natural Origin Ingredients | Zero White Cast | 98% Broad Spectrum Protection | Sweat & Water Resistant | For Men & Women | 100ml
- GARNIER Men Acno Fight Anti Pimple Face Wash 100g + Super UV Invisible Serum Sunscreen 30ml (2 Items in the set)
- Rexona Aloe Vera Underarm Roll On Deodorant For Women (PO3) Deodorant Roll-on – For Women (150 ml, Pack of 3)
- Toshiba 126 cm (50 Inches) 4K Ultra HD Smart QLED TV | Dolby Atmos, HDR10+ | 24W Powerful Speakers | AI Sports Mode | REGZA Engine ZR | Voice Control | AI 4K Upscaling | VIDAA OS | 50M450RP (Black)
- Skechers Men Mumbai Indians IPL Travel Royal Polo 2025
- CELLO MF Click Lunch Box with Insulated Jacket, Brown | 3 x 300ml Containers, 1 x 180 ml Pickel Container, Spoon & Fork | Food Grade, BPA Free PET Body | Airtight Clip Lock, Leakproof Tiffin Box Set
- Asian Inner Steel Casserole Gift Set of 3,| PU Insulated | BPA Free |Easy to Store | Ideal for Chapatti |Serving Casserole Red.
- Fiama Gel Bar Patchouli And Macadamia For Soft Glowing Skin, 375g (125g – Pack of 3), with Skin Conditioners, Skin Friendly pH, Soap for Women & Men, For All Skin Types
- Kwality Muesli Cranberry, Fruits, Seeds & Crunch 400g | 69% MultiGrains Mix | Goodness Millets Brown Rice & Oats | High-Fibre, Protein-Rich Multigrain Breakfast Cereal with Rolled Oats, Super Seeds & Real Cranberries | No Preservatives
- MarwarBites Premium Mixed Dry Fruits 1kg | Mix Nuts and Dry Fruit Combo | Almonds, Cashews, Walnuts, Raisins & More | Resealable Jar Pack | Fresh and Crunchy Snack for Gift
- Zaib Stainless Steel Lunch Box for Kids with Insulated Carry Bag | 3 Containers: 2x350ml + 1x400ml Rice Bowl | Durable, Leak-Proof & BPA-Free Tiffin Box for School, Travel & Picnics (Executive 2+1)
- JBL Go Essential with Rich Base, Wireless Ultra Portable Bluetooth Speaker, Vibrant Colors, Waterproof, Type C (Without Mic, Black)
- SUGAR Cosmetics Partner In Shine Transferproof Glossy Lipstick | Lasts upto 24hrs | Transferproof & Smudgeproof – 3ml – 11 Ruby Rioja
- Clazkit Kitchen Dori Handy Vegetable and Fruit Manual Onion Dry Fruit Salad Maker Vegetable Quick String Chopper Machine, Cutter – 3 Stainless Steel Blades -900ml
- Boldfit High Density Foam Yoga Block for Stretching & Balancing – Premium Accessory for Women & Men – Purple
- PETER ENGLAND Men Printed Round Neck Polycotton Green, Grey T-Shirt
- Horlicks Chocolate Nutrition Drink, 1 kg Jar
- Wild Stone Edge Premium Perfume Spray For Men, 30Ml|Long Lasting Eau De Parfum|Luxury Fragrances
- Halonix 15W Motion Sensor Led bulb | Color-6500K White | Auto on- Auto Off light | Motion sensor light | Pack of 1 | Base-B22
- Engineered Wood Foldable Round Shaped Side Table (Black)
- Clean & Clear Foaming Facewash for Oily Skin, Brown, 240ml (Pack of 2)
- Double Bucket Mop Wringer Trolley Free with Caution Sign Board Combo Wet Floor & Cleaning in Progress – 40 LTR
- Steelo Stack & Lock Plastic Kitchen Storage Square Container Set – Air Tight, Fridge safe, US FDA Approved, PET Food Grade Heavy Duty Material, BPA Free (Clear, 750 ml, Pack of 4)
- Jack Royal Battery Operated Walking Elephant Funny Toy with Light and Sound for Kids (Multicolour)
- Amazon Basics 5.9L Instant Water Heater | 3KW | Geyser with PP Body & SS Tank | Corded Electric | Rust Proof | 4 Level Safety | White
- Secret Temptation Jazz Long Lasting Perfume for Women 30 ML
- Streax Serum Shine Shampoo, 490ml |Shampoo for Frizzy and Dry Hair |Mildy everyday |for Women & Men,Paraben-Free with Silicon Boosters & Vit B5 | For Smooth & Shiny Hair
- Boat Aavante 2.1 1200, 120W Signature Sound, 2.1 CH w/Wired Subwoofer, BT v5.4, Multiple Ports, EQ Modes & Remote Control, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- Samsung Original 25W USB Type-C Travel Adaptor Without Cable for Google Pixel, Xiaomi, Motorola, iPhone, Samsung Galaxy Tab S/A Series, Galaxy S10/M54/M55/A80/A90/S25/S24, White
- HARVEYS CRUNCHY & CREAME WAFERS || Wafer || Biscuits || Pack of 4 ||150g x 4 || 600g (Orange)
- SKYBAGS Dune Backpack | Premium Diamond pattern fabric | Upto 17 inch Laptop Portection | 02 Compartment | For Office and Casual Unisex Men Women Boys Girls
- Westinghouse 80 cm (32 inches) W2 Series HD Ready Certified Android LED TV WH32HX41 (Black)
- Scott International Men’s Rich Cotton Regular Fit Striper Polo T-Shirt |
- IFB Model Silver Plus Smart Series 1.5 Ton 5 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI185SL22SGN1, Copper Condenser)
- GreenFinity Healthy Seeds Combo Pack- Pumpkin-150g, Sunflower-150g, Chia Seeds-175g | Rich in Fiber, Omega and Nutrients | Gluten Free Seeds for Weight Management, Snacks, Smoothies, Baking and Salads
- Pspeaches Girls Kurta Set
- Libas Womens Embroidered Georgette Gown Dress for Women
- KC Stainless Steel Heavy Gauge Floral Dinner Set | Kitchen Set for Home | Lazer Design | Shagun | Bartan (Laser 16 Pcs)
- Havells DHMGBSPF025 PVC Plastic 25A MCB SP B Curve (White)
- Nature Purify Dry fruits Combo 1.5kg (Almond, Cashew, Apricots, Black Raisin, Amla Candy, Mixed Nut & More.)
- Nescafe Gold Decaf Cappuccino Unsweetened Coffee, 120 g
- Mee Mee Bundle of Joy Baby Gift Set (Pack of 4) | Newborn Baby Care Essentials Kit | Ideal Gift for Baby Shower & Newborn Babies
- Anveshan Kashmiri Mongra Saffron 1Gm | Kesar Keshar,A+++ Grade,Untouched Long Kesar Threads For Pregnant Women,Milk,Biryani,Cooking,Skin,Iso Certified
- Ajanta Plastic Abstract Wall Clock (28 Cm X 28 Cm X 3.5 Cm, White) – Analog
- Biotique Cucumber Pore Tightening Toner| Ayurvedic and Organically Pure| Maintains Skin’s Natural pH |100% Botanical Extracts| Suitable for Normal & Oily Skin Types| 200ml
- JioTag Air for iOS (Blue) Worldwide Tracker, Pair with Apple Find My app for keys, luggage, bikes, purses etc. inside & outside Bluetooth range, No SIM/subscriptions required, 1+1 year battery, 120 dB
- Date Farm Zahidi Luxury & 100% Natural Khajur, Boosts Immunity, A…more
- Premium 6 in 1 Multi-Function Blackhead Removal With Pimples & Pore Cleaner Upgraded Chargeable Vacuum Device/With 6 Changeable Functional Heads With 3 Levels Adjustable Mode(Jumbo) (Jumbo)
- Lexton Multicolor Cork Light | 20 Led | Multicolor | Pack of 1 | for Indoor & Outdoor Decorations
- Electric Head,Scalp Massager | Advance Red Light Therapy for Boost Growth Fall Control Therapy | 3 Speed Mode Handheld,Portable,Scalp Scratcher Body Massage for Growth,Deep Clean & Stress Relaxation
- Vishudh Women’s Kurta | Regular Fit | Trendy Ethnic Top for Everyday Comfort
- Colombian Brew Pure Instant Coffee Powder – Smooth & Strong- 45g Pack- 100% Coffee, Instant Coffee for Hot & Iced Drinks, Quick Brew, Rich Aroma
- PrettyKrafts Set of 6 Non-Woven Printed Foldable Saree Covers/Wardrobe Organizer With Transparent Window And Zip/Clothes Storage Bag For Women’s Lehenga, Suit Saree & Other Accessories (Orange)
- Vega SmartOne S3 Beard Trimmer for Men with AI SmartTrim Technology, USB Type C, Titanium Blade,160 mins Runtime, IPX7 Waterproof & 40 Length Settings, Shaving Machine, Travel Lock, Green, (VHTH-36)
- wipro Garnet 3W Led Mini Downlight for Home & Cabinet| Warm White (2700K) | Compact Design with 120° Beam Angle | Recessed Down Light for False Ceiling | Cutout-2.3 Inch | Pack of 1
- Nikunj Dhaba Special Leaf Tea, 1kg
- CP PLUS CarKam Car Dashcam with 1080p Full Hd Resolution | Wide View Angle | Supports G Sensor | Supports Night Vision| Suitable for Large Cars & SUVs | CP-AD-H2B-W
- Philips TAT1269 Bluetooth Truly Wireless in Ear Earbuds with mic, 13mm Drivers, Bluetooth 5.4, 40H Playtime, IPX5, Fast Charging, Touch Controls, Voice Assistant, Mono Mode, LED Indicator (Deep Black)
- Philips TAT1269 Bluetooth Truly Wireless in Ear Earbuds with mic, 13mm Drivers, BT 5.4, 40H Playtime, IPX5, Fast Charging, Touch Controls, Voice Assistant, Mono Mode, LED Indicator (Bright White)
- Yogabar Power Up 20g Protein Bar (5 Bars, Variety Pack, No Added Sugar) | Zero Added Sugar Protein Bars | High Protein Blend – Whey Protein Concentrate, Peanuts & Soy
- Gulabari White Rose Soap – 450g (150g x 3) | Moisturizing Bathing Soap for Soft, Glowing Skin for Skin & Body | Goodness of Almond Milk, Honey & Niacinamide
- Solimo Microfibre Reversible Comforter, Double (Subtle Beige & Walnut Brown, 200 GSM), 50 TC
- THE LOVE CO Japanese Cherry Blossom Shower Gel 100Ml | Aloe & Vitamin E for Hydration & Skin Nourishment | 100% Vegan & Paraben-Free | Luxurious, Long-Lasting Fragrance | For Women & Men
- La French Man Perfume Gift Set 3 x 30 ml for Men | with Belief Bestow Bespoke Perfume | Woody, Citrusy Long Lasting EDP Fragrance Scent Best Gift Hamper Set for Men
- Zebronics Wattz 60CC2 Type-C to Type-C Soft Silicone Cable, PD 60W, 1 Meter, Durable, Charge & Sync, Rapid Charging, For Laptops, Tablets, Mobiles (Black)
- Daawat Pulav Basmati Rice 1.5 Kg
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 6th April 2026
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 6th April 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 6th April 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato