Pages
- Best Laptops Deals January 2026
- Best Smart Watches January 2026
- Mobiles
- Amazon Deals & Offers for January 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 10th January 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Apple 2025 MacBook Air (13-inch, Apple M4 chip with 10-core CPU and 8-core GPU, 16GB Unified Memory, 256GB) – Midnight
- Chocolate Full Body Wax Powder for Women and Men – Facial Hair Removal For Woman Painless Bikini Wax Powder Hair Remover Brazilian Aloe Vera Herbal Home Waxing Solution Organic 100g
- Steelbird SA-2 Aeronautics Motorbike Helmet (Matt D.Storm)
- BAJAJ Almond Drops Nourishing Body Lotion (400 ml)
- Mivi Fort H750 Soundbar, 750 Watts, Dolby Audio, 5.1 Channel, Multi-Input & EQ Modes 750 W Bluetooth Soundbar (Black, 5.1 Channel)
- HabibaArtGallery Wall TV set up box Stand & Wifi Stand MDF MDF (Medium Density Fiber) Wall Shelf (Number of Shelves – 4, Black)
- Reynolds Lubriglide Ball Pen (Pack of 40, Ink Color – Blue Black)
- MILTON Plastic Utility Container – 200 ml, 400 ml, 600 ml, 1000 ml, 2000 ml, 3000 ml (Pack of 6, Pink)
- Funtastik Plant Hanging Pot with Rust-Free Chain | Classic Round Woven Style Garden Baske Plant Container Set (Pack of 4, Plastic)
- Mivi Fort H120 Soundbar, 120 Watts, 2.1 Channel, Multi-Input and EQ Modes, BT v5.1 120 W Bluetooth Soundbar (Black, 5.1 Channel)
- Prestige 3 Litre Aluminium Nakshatra+ Svachh Innerlid Pressure Cooker Handi|Deep lid for spillage control|Virgin Aluminium|Induction Compatible|Metallic Safety Plug|5 Years warranty|ISI Certified
- L’Oreal Paris Deep Conditioner, With Micro-Oils, Deeply Nourishes Dry Hair, No-Leave In Time, Rapid Reviver 6 Oil Nourish, 180ml
- MILTON Costa 1000 Pet Water Bottle Set of 2, 1 Litre Each | Airtight & Leakproof Stainless Steel Lid | Unbreakable, BPA-Free, Reusable Plastic Fridge Bottles for Home, Office, School, Travel
- GOBOULT W20 Truly Wireless in Ear Earbuds with 40H Playtime, Zen™ ENC Mic, 45ms Low Latency, 13mm Bass Drivers, Type-C Fast Charging, Touch Control, IPX5 Ear Buds TWS (Glacier Blue)
- LILA DRY FRUITS Cashews 500 Grams | Natural and Unsalted Whole Cashew | Premium Kaju Ideal for Dieting, Snacking, Cooking, and Baking | Protein Rich Kajau Dry Fruits Perfect for Gifting
- SofTouch 2X French Perfume Fabric Conditioner Refill Pack by Wipro, 2000ml
- Sounce 4-Port USB 3.0 Hub for PC – High-Speed Aluminum USB Hub Compatible with PC, MacBook, Mac Pro, Mac mini, iMac, Surface Pro, and XPS. 4-Port High Speed USB Hub with Aluminium Shell
- CELLO Athlete Flip Top Lid Water Bottles Set of 2, 800ml Each | Unbreakable & Hygienic | BPA-Free, Food Grade | Airtight, Leakproof | Plastic Water Bottle Set For Fridge, Home, Kitchen, Gift
- Bikano Teekha Mixture | Spicy Indian Namkeen Snack | Crunchy Mix with Peanuts, Corn Flakes & Spices | Perfect Tea-Time Snack (Spicy Mixture) – 800g
- Olay Total Effects Cleanser,With Salicylic Acid & Exfoliating Silica Beads,Throughly Cleanse & Exfoliate Skin For Glowing,Younger Looking Skin,Suitable For Normal,Dry,Oily & Combination Skin,100 Gm
- Surf Excel Matic Front Load Liquid Detergent 5L Refill Pouch, Specially designed to remove Tough Dried Stains, 1st time in Washing Machine
- Nike Unisex N150 Woman Magic Passion Edt Spray
- Godrej aer Matic Kit (Machine + 1 Refill) – Automatic Room Fresheners with Flexi Control Spray | Violet Valley Bloom | 2200 Sprays Guaranteed | Lasts up to 60 days (210ml)
- Lux Essence of Himalayas | Cedarwood Oil & Cica|100% Natural himalayan oil | Soothing Body Wash 400 ml
- Beardo Activated Charcoal Peel Off Mask for Men, 50g | Charcoal Face Mask for Glowing Skin | Detoxing Facial Kit for Men | Peel Off Mask For Oily & Dirt free skin
- Toyzone My 1st cubie-81418- Block Game|Plastic Blocks|Learning Toy|Block Puzzle|Puzzle|Brick Game|Block Toy|Block for Kids(My 1st cubie)
- Parachute Advansed Olive Enriched Coconut Hair Oil for Stronger Nourished Hair | 300ml | Ultimate nourishment with Olive | Coconut for strengthening | Upto 10x less hair fall & 90% stronger hair
- Sunfeast Dark Fantasy Choco Fills, 460g Original Filled Cookies with Choco Crème | Perfect Snack
- Murphy PowerZap Mosquito Killer Bat | Fast-Charge Rechargeable Electric Racket with LED Light | Instant Kill, Long Battery, 6-Month Warranty | Made in India
- Active White Liquid Detergent – 5L Mega Pack | Lavender Fragrance | Front Load & Top Load Machine Wash & Bucket Wash Expert | Powerful Stain Removal | Gentle on Clothes | Value Family Refill Pack
- Ambrane Wireless Mouse with 2.4GHz, USB Nano Dongle, Silent Click, Optical Orientation Click Wheel, 4 Buttons, 1600 Adjustable DPI, Both Hand Use, Compatible with PC, Mac, Laptop (Sliq 3, Black)
- FRONTECH Wired Keyboard and Mouse Combo | Membrane Keys with Retractable Stands | USB Plug & Play | Ergonomic & Comfortable Design | 1 Year Warranty (1692, Black)
- Nayasa Plastic Sqr DLX 3 Pcs Bathroom Set | Bucket 18 L + Mug 1.5 L + 508 DLX Stool | Bathroom Set | Bath Set for Bathroom | Off – White
- AADHIK Multipurpose Kitchen Scissor with Cover | Stainless Steel Black Kitchen Knife for Cutting Vegetables, Fruits, Meat, Chicken, Seafood | Latest Kitchen Tools & Accessories
- Cello Magic Hand Vegetable Slicer Chopper Small | Multi Utility | 3 Stainless Steel Blades | Vegetable and Fruits | 15 Cuts One Pull | (Blade, Whipper) | 450 ml| Green
- HIKVISION 2Mp Indoor Wired Color Camera for Dvr Ds-2Ce5Ad0T-Itp Eco Bnc/Dc, White – 1080P
- India Gate Basmati Rice Everyday 5 kg
- Tata Tea Gold 1kg, Premium Assam Teas With Gently Rolled Aromatic Long Loose Leaves, Rich & Aromatic Chai, Black Tea
- Crompton 9 W Basic Standard B22 LED Bulb (White, Pack of 2)
- Perfora Tongue Cleaner & The Daily Routine Awake & Unwind Combo Toothpaste (200 g, Pack of 3)
- Olay Total Effects Foaming Cleanser & Face Wash To Fight 7 Signs of Ageing – 100g
- wipro Garnet 7W LED Bulb for Home & Office |Warm White (2700K) | E27 Base|220 Degree Light Coverage |4Kv Surge Protection |400V High Voltage Protection |Energy Efficient | Pack of 3
- Revlon Men Set of Top Speed Hair Color – Dark Brown 65M & Free Outrageous Conditioner
- Hair & Care with Almond, Non-Sticky Hair Oil, 500ml
- CELLO Nadir Square Stackable Bowl 1.1 Litre 17 cm | Multipurpose Clear Glass Bowl for Kitchen and Table Use
- CELLO Zenith Round Stack Bowl 1 Litre 17 cm | Clear Glass Bowl for Mixing Storing and Serving
- Cello Kleeno Dual Action Sink & Dish Brush, Blue & White | Flexible Bristles, Hanging Provision | Rubberised Handle & Tough Bristles for Stubborn Stains |Plastic Kitchen Sink Basin Wash Cleaning Brush
- CELLO Double Treat Stainless Steel Lunch Box with Bag, Black | 2 x 300 ml Steel Containers, 1 x Oval Container | Food Grade, BPA Free, Rust & Leakproof, Airtight Snaplock Mini Tiffin Box for Office
- CELLO Estonia Juice Tumbler Glass Set 200 ml | Set of 6 | Clear Glass Tumblers for Water Juice and Everyday Beverages
- CELLO Glaze Tumbler Glasses Set of 6, 180 ml Transparent | Dishwasher Safe Toughened Crystal Clear Glass | Daily Use Tranparent Drinking Glass Set for Water, Cocktail, Juice, Milkshake, Coke, Soda
- Groomiist 20Watts Gold Series Ghs-69 Magical Curl Salon Quality Automatic Hair Curler With Titanium Coated & Various Temperature Settings,Gives You Long Lasting Curls|Hair Styling Tool
- CELLO Kitchen Pro Trolley with Wheels | Storage Organizer & Kitchen Accessories Items for Kitchen Storage Rack Square Design Fruits & Vegetable Onion Cutlery | Multi-Purpose Trolley | (Black,Layer 2)
- 4-in-1 Skincare Red Light Therapy Wand – EMS Microcurrent – Rechargeable Vibrating Red Light Therapy Therapeutic Facial Skin Care Tool Eye Beauty Wand Face Massager
- Dr.Ortho Capsules 30Caps (Pack Of 3)
- Urban Platter Nutritional Yeast Flakes, 70g (Unfortified | Plant Based | Nutty and Cheesy Flavour)
- 3 by 3 Speed Cube
- AmazonBasics Standup Patio Heater Cover | Height: 95 inch, Dome Diameter: 34 inch, Round Base Diameter: 18.5 inch | Polyester | White
- Wifi Cct Smart Bulb Powered By Jio Iot| 12 Watt,| Tuneable White, Shades Of White From Warm To Cool White | Compatible With Amazon Alexa And Google Assistant (Pack Of 1) – B22D, Led
- Water Resistant Bike Cover Compatible with (TVS Jupiter), Rain, UV, Dust and Scratch Proof, All-Weather Proof Full Body Bike Cover Five Thread Stitched (Interlock) Pack of 1
- VIVI Natural Honey – 1kg | 100% Pure Multi-Flora Honey | No Sugar Adulteration | Naturally Rich in Anti-Oxidants | Non-GMO Project Verified | Globally Certified
- Fire‑Boltt Phoenix Classic Round Smart Watch 1.39″ HD Display with Bluetooth Calling,AI Voice Assistant,SpO2 & Heart Rate Monitor, 120+ Sports Modes,IP67 Waterproof Smart Watch for Men & Women – White
- Fiama Body Wash Shower Gel Patchouli & Macadamia, 250ml, Body Wash for Women & Men with Skin Conditioners For Soft, Glowing Skin, Suitable for All Skin Types
- La French Rahil Oud Perfume for Men & Women 100ml Eau De Parfum with Premium Luxury Arabic & French Fragrance Notes with Oud Vanilla Musk Incense Sandalwood Amber Woody Fragrance Scent Long Lasting
- Kalaanj Women Women Kurta Set
- Boat 2025 Launch Stone 1200 Pro, 60W Boat Signature Sound, 76.2mm Drivers, TWS,7.5H Battery, Built-in Mic, Carry Strap,IPX6, Bluetooth Speaker, Wireless Speaker, Portable Speaker (Ice Grey)
- Scott International Hoodies for Men | Cotton Hoodies | Hoodie for Mens Stylish | Sweatshirt for Men | Hooded Sweatshirt for Man | Pullover for Mens | Winter wear Hooded Jacket
- Dream Shop Engineered Wood TV Entertainment Unit (Finish Color – Brown, DIY(Do-It-Yourself))
- Crompton SUREBREEZE HILL BRIZ NEO 1200 mm (48 inch) Ceiling Fan (Smoked Brown) Star rated energy efficient fans
- Kellogg’s Muesli 0% Added Sugar 500 G | 12-In-1 Power Breakfast | India’s No. 1 Muesli
- LITTLE NINJA Pure Cotton Knee Length Half Sleeve Cute Puppy Printed Tee & Shorts Set – Sky Blue 0-6M
- Portronics Toad 103 Wired Optical Mouse with 2400 DPI, Plug & Play, Ambidextrous, Hi-Optical Tracking, 1.5M Cable Length, 30 Lakhs Click Life, Ergonomic Mouse for Comfortable All-Day Grip (Black)
- La French Rio Eau de Parfum – 100ml Unisex Perfume for Men and Women | Intense Long Lasting Perfume | Fresh, Spicy Aqua Notes | Premium Fragrance Scent EDP | Best Gift Perfume for Man and Woman
- OSCAR Big Shot Jazz Club, Privee, Eros & Red (150mlx4) Long Lasting Body Deo Deodorant Spray – For Men & Women (600 ml, Pack of 4)
- BSB HOME 3 Layered Heavy Winter Quilt | Rajai – 600 GSM Thick & Fluffy Comforter, Ultra Warm Double Bed Blanket for Extreme Cold Weather Weight 3 kg, Pattren – Quilted Floral, Colour – Green & White
- Rexona Advanced Protection Bamboo & Aloe Vera with MotionSense | 0% Alcohol | 72H Non Stop Protection | For Women | 200 ML (Pack of 2)
- GM Fresho Plus 150mm Ventilation Fan AF W/O Louvers-White
- RK Stainless Steel, Plastic Utility Container – 200 ml, 350 ml, 600 ml, 850 ml, 1150 ml (Pack of 5, Silver)
- boAt Nirvana Ion ANC, Active Noise Cancellation(~32dB), 120Hrs Battery, App Support, Crystal Bionic Sound, 4Mics ENx, v5.3 Bluetooth TWS in Ear Earbuds Wireless Earphones with mic (Quartz White)
- Polycab Wizzy Neo 1200mm 5-Star BLDC, Remote Ceiling fan for Living Room| 55% Energy Saving, 100% Copper, High Air Delivery, Reversible & Timer | 3+1 yr Warranty
- All Out Ultra Liquid Vaporizer, Machine + 3 Refills (45ml each) | Kills Dengue, Malaria & Chikungunya Spreading Mosquitoes| India’s Only Mosquito Killer Brand Recommended by Indian Medical Association
- HSR Stainless Steel, Plastic Egg Boiler Electric Automatic Off 7 Egg Cooker Poacher For Steaming, Cooking, Boiling And Frying (350 Watts), White, Orange
- Zimli Women Night Suit Set Grey Printed
- SOLARA Premium Cast Iron Frying Pan 10 Inch/25 Cm with Handle, Castiron Fry Pan 2.1Kg, 100% Pure and Toxin-Free Cast-Iron Fish Fry Pan/Skillet
- Rexona Shower Fresh Underarm Roll On Deodorant + Antiperspirant For Women|| 50 ml+Rexona Powder Dry Underarm Roll On Deodorant + Antiperspirant For Women|| 50 ml
- JIVO Cold Pressed Kachi Ghani Chemical Free Mustard Daily Cooking Oil, 1 Litre | Recommended for Roasting, Frying, Baking All type of Cuisines |
- Plastic Food Storage Container,Fridge Organizer Case with Removable Drain Plate Stackable Freezer Storage Containers 1500 ML Keep Fresh for Storing Fish,Meat,Vegetables(Pack Of 2),Transparent
- Ayurvedic Josh Booster Libidex40 UP Capsules for Men Original – Health Supplement Crafted with Natural Ingredients for Better Result Than Other Tablets (Pack of 2)
- ANTIL’S® Hot Water Bag (2 Litre) – Non-Electric Rubber Heating Bag for Pain Relief, Period Cramps, Body Aches & Cold Therapy | Reusable Hot & Cold Water Bottle | Multicolor
- Boat 2025 Launch, PartyPal 65 Pro, 42W Signature Sound, Wireless Karaoke Mic, 8H Battery,RGB LEDs, TWS, Bass Boost, Multi Port, Bluetooth Speaker, Wireless Speaker, Portable Speaker (Premium Black)
- Safari Pentagon Neo 8 Wheels 66Cm Medium Checkin Trolley Bag, Hard Case Polypropylene 360 Degree Wheeling Luggage for Men & Women, Travel Bag, Suitcase for Travel, Trolley Bags for Travel, Ink Blue
- Huggies Natural Soft Premium Baby Diaper Pants, Our No.1 Soft Pants, Large (L) Size (9-14 Kgs), Monthly Pack of 100 diapers | Cloud Softness All over with India’s 1st Cloud Touch BeltTM
- The Indian Garage Co Men’s Slim Fit Mid Rise Jeans
- boAt Aavante 5.2.4 Prime 6250DA (2025 Launch), Dolby Atmos, 625W, 5.2.4CH(Dual Subwoofers & Wireless Satellites),Multi Connectivity, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- S2M Herbal Rosemery Lavender Soap 250gm
- RK Stainless Steel, Plastic Utility Container – 200 ml, 350 ml, 600 ml, 850 ml, 1150 ml (Pack of 5, Silver)
- RK Steel Cookie Jar – 300 ml, 500 ml, 750 ml, 1150 ml, 1650 ml (Pack of 5, Silver)
- Britannia Good Day Choco Chip Cookies, 400 g
- Lifelong Cuppy Smiling Ride-On for Kids|Baby Car Ride On|Baby Car for 1+ Years|Push Ride On for Kids Driving|Rider for Baby|Baby Push Car Toy|Fun & Engaging Playtime (LLCKSR01),Multicolour
- Halonix 9W B22 LED Cool White Bulb, Pack of 10
- Aristocrat Striker Cabin Size Softshell Luggage (55 Cm) | Spacious Polyester Inline Trolley Bag with 4 Wheels and Combination Lock | Dazzling Dark Blue | Unisex| 3 Years Warranty, Large
- Dixcy Scott Originals Pack of 5 Solid Men Trunk
- ISZK Liquid Detergent 10L Ultra Wash Front load & Top Load machine liquid detergent Lavender Liquid Detergent (2 x 5000 ml)
- Ariel Power Gel Liquid Detergent for Top Load & Semi Auto – 6kg | Removes 100 Dried Stains in 1 Wash | Faster Dissolving | Long-Lasting Fragrance | Color Protection | At the price of Powders
- French Connection Analog Women’s Watch (Dial Colored Strap)
- Fastrack Tropical Waters Analog Green Dial Women’s Watch-NM68010SM07 / NL68010SM07/NP68010SM07
- Hair & Care with Almond,Non-Sticky Hair Oil, 300 ml
- Flat Rs.1500 OFF on Domestic Round Trip Flights
- SLAZENGER Men Solid Black Track Pants
- VGRASSP Catapult Toy Airplane, Pistol Shooting Game Toy Gun Air Battle Glider Airplane Launcher Toy for Kids Outdoor Sport Aircraft All Occasions Exciting and Fun Gift for Boys and Girls
- Q2 Nut (Dried Chuara/Peela Sukha Khajoor, 1000g (4x250g))
- Metal (Pack of 2 Self-Adhesive Shelf/Storage Organizer for Bathroom and Corner Wall Mounted Rack Shelf Bathroom Accessories Storage Rack (No Drilling-Shelf Adhesive) (Black Style 1)
- Crompton Laser Ray Neo 20W LED Batten | Energy Efficient Batten for Home | Cool Daylight | Pack of 4
- Beard Serum 50ml,Beard Softener 50g & GodFather Beard Wash 100ml (Set of 3) | Ultimate Beard Growth & Softening Kit for Men – Beard Serum, Beard Conditioner, and Beard Shampoo for Nourished, Shiny & Healthy Beard – All-in-One Grooming Kit for Men
- boAt Tag Bluetooth Item Finder for iOS | Apple Find My Network & Android Google Find Hub, Finder for Keys, Luggage, Bikes etc, in-Built Alarm, 1 Year Battery + Free Battery Replacement (Carbon Black)
- Toilet Flush Tank Cleaner Tablet | Automatic Blue Bubble Cleaning Tablet | For Flush Tank Use| Pack of 10
- Table Analog Clock Alarm Super Loud for Heavy Sleepers Retro Twin Bell Metal Frame Clock with Night Backlight Function Bedside Luminous Alarm for Bedroom/Office (Silver Luminous)
- BSB HOME 120 TC Double Abstract Printed Bedsheet with 2 Pillow Covers | 110 GSM Soft Brushed Microfiber – Breathable & Wrinkle Free – (86 X 88 Inch, Dark Blue & Beige & Brown)
- SAMSUNG MB-MC128SA Plus 128 GB MicroSDXC Class 10 160 MB/s 128 GB MicroSD Card Class 10 160 MB/s Memory Card Compatible with Mobile
- SUNSILK CO-CREATIONS BLACK SHINE SHAMPOO (650 ml)
- boAt Rockerz 245 v2 Pro, 30HRS Battery, ENx Tech, Fast Charge, Low Latency, Dual Pairing, Magnetic Ear Buds, IPX5, Type-C Interface, Bluetooth Neckband with Mic in Ear Earphones (Active Black)
- Huggies Natural Soft Premium Baby Diaper Pants, Our No.1 Soft Pants, Small (S) Size (4-8 Kgs), Pack of 70 diapers | Cloud Softness All over with India’s 1st Cloud Touch BeltTM
- Kinbor WAVE HB Graphite Pencils – Pack of 30 | Ergonomic Grip with Wavy Anti-Slip Design | Smooth Writing, Break-Resistant Lead | Ideal for School, Office & Sketching
- Boat 2025 Launch Aavante Prime 5.1 7050D, Dolby Audio, 700W Signature Sound, 5.1CH with Wireless Subwoofer & Wireless Satellites, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- Boat 2025 Launch Stone 1200 Pro, 60W Boat Signature Sound, 76.2mm Drivers, TWS,7.5H Battery, Built-in Mic, Carry Strap,IPX6, Bluetooth Speaker, Wireless Speaker, Portable Speaker (Twilight Black)
- Kadio Analog 24.5 cm X 24.5 cm Wall Clock (Maroon, with Glass, Standard)
- Aeropostale Men Printed Sliders
- Aeropostale Men Brand Logo Printed Sliders
- Skybags Cabin Paratrip Hardshell Luggage (55 Cm) | Polypropylene Luggage 4 Wheel Inline Trolley Bag with 8 Wheels | Bumblebee | Unisex, Small, Yellow
- Skybags Riddle 1 Black 45 Cms Casual Standard Backpack
- Sunfeast Farmlite Oats & Almonds Cookies 300gm
- Saffola Peanut Butter with Jaggery, Crunchy 350 gm | High Protein Peanut Butter | No Refined Sugar
- Huggies Natural Soft Premium Baby Diaper Pants, Our No.1 Soft Pants, Medium (M) Size (7-12 Kgs), Pack of 60 diapers | Cloud Softness All over with India’s 1st Cloud Touch BeltTM
- Yu Foodlabs – 100% Natural Coconut Water – Zero Preservatives – No Added Sugar – 600Ml (Pack Of 3)
- Puma Womens Seriah WNS Running Shoe
- Inalsa Vactidy 2-in-1 Handheld & Stick for Home&Car|2200mAh Battery|14Kpa Suction| Cordless Vacuum Cleaner (Black)
- Inalsa 250 W Black Hand Blender (Easy Mix Mixer)
- Kellogg’s Multigrain plus Corn Flakes 450 G | Power of 5 Grains | 6 Vitamins | High Iron | High Fibre | Crunchy & Delicious | Protein | Only 2% Fat | Breakfast Cereal
- Sony MDR-ZX110A Wired On Ear Headphone without Mic
- ThriveCo Rosemary Essential Oil | Helps Promote Hair Growth & Control Hair Fall | 100% Pure & Organic | With Vitamin E | Strengthens Hair & Supports Scalp Health | For Men & Women | 15 ml
- WOW! Veg Manchurian Noodles (Pack of 2)
- Orika Malabar Black Pepper (80 g)
- Loyka Caramel Almonds Dates Box – 100 gm box | Crunchy | Gift Hamper| No Refined Sugar Added | Made with Jaggery | Diet friendly | Healthy guilt-free morning/evening snack |Gluten-free
- Just Party 25Pcs Red & 25Pcs Lavender Metallic Chrome Balloons with Shiny Surface For Birthdays/Anniversary/Engagement/Baby Shower/bachelorette Party Decorations (Pack of 50)
- HEMITO Premium Metallic Latex Balloons Pack Of 50 Red Balloons for Decoration (Red, Pack Of 50)
- Bikano Patisa | Festive Sweet | Traditional Indian Sweet | 400g
- Reebok Mens Rmsowa3594 Sneaker
- LONGWAY Creta P1 600 mm/24 inch Ultra High Speed 4 Blade Anti-Dust Decorative Star Rated Remote Controlled Ceiling Fan (Rusty Brown, Pack of 1)
- Havells Ambrose Es Ceiling Fan 1200Mm Energy Saving Decorative Fan 100% Pure Copper Motor, High Air Delivery, Premium Matt Finish, 2 Year Warranty, Elegant Looks,Pack Of 1, Copper
- Sugar Free D’Lite Chocolate Coated Almonds Gift Pack, 100 g
- Carrylux Dual Tone Large Capacity Croco Pattern Tote Handbags Purses Shoulder Bag For Womens
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- Lee Cooper Mens Lc4156l Sneaker
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
Quiz
- Amazon FunZone Quiz Answers Today – 10th January 2026
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Achanta Sharath Kamal represents India in which sport?
- In 2024, who became the youngest person to win two Oscars?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which director won his first directing Oscar in 2024?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Who became the 17th Indian to score a century in Test debut?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- National Rifle Association of India is associated with which sport?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Ligue 1 is the top national league in which country?
- Who became the first Indian woman to score 50 international goals in 2024?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- The iconic Air India building at Nariman Point was handed over to which state government?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 10th January 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Amazon FZ Runs Daily Quiz Answers 10th January 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato