Pages
- Best Laptops Deals February 2026
- Best Smart Watches February 2026
- Mobiles
- Amazon Deals & Offers for February 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 24th February 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Palmolive Aroma Morning Boost Body Wash For Women & Men,750Ml Shower Gel Refill Pack,100% Natural Citrus Essential Oil Lemongrass Extracts A Soft Smooth Skin,Ph Balanced,Free Of Parabens Silicones ?
- NIVEA Lip Caring Beauty Rose Lip Balm | Lip & Cheek Tint with SPF 30
- AXE Alaska 3 In 1 Body, Face & Hair Wash for Men, Long-Lasting Refreshing Ocean Air & Bergamot Fragrance Natural Origin Ingredients,Removes Odor & Bacteria, No Parabens, Dermatologically Tested, 250ml
- Lifebuoy Set Of 3 Total 10 Anti-Baceterial Body Wash With Activ Silver Formula – 1L Each
- Oshotto Anti Skid Rubber Car Tray Foot Mat Compatible with Renault Kwid (Set of 5, Beige)
- Boat Rockerz 330 in Ear Bluetooth Neckband with Upto 30 Hours Playtime, ASAP Charge, Signature Sound, Dual Pairing & IPX5 with Mic (Active Black)
- Zebronics Zeb-CTE100 Type C to RJ45 Ethernet LAN Adapter, Up to 1000 Mbps, for Windows/Mac/Linux (Black)
- Lakmé VitC Srglow Skin Perfecting Tint Warm Crme W120 Foundation (Warm Crme, 25 ml)
- Dabur Gluco Plus-C Instant Energy Glucose Powder (Lemon), 1kg | 99.4% Pure Glucose | Enriched with Calcium & Vitamin C | Refreshing Energy Drink
- Crompton Dyna Ray 9 Watt LED Bulb Cool Day Light | Pack of 1 | B22 Base, Energy-Efficient | LED Bulb for Home & Office, Wide Light Spread
- Yardley London Gentleman Luxury Perfume Gift Set
- Parachute Advansed Deep Nourish Body Lotion for Women & Men, Dry Skin, 400ml | Pure Coconut Milk, 100% Natural, 72h Moisturisation
- DJI Mic Mini (1 TX + 1 RX), Ultralight, Detail-Rich Audio, Noise Cancelling, Automatic Limiting, Wireless Microphone for Camera/iPhone/Android, Vlog, Streaming, 400m Transmission
- Mamaearth Beetroot Tinted 100% Natural Lip Balm with Beetroot & Beeswax for 12h Moisturized Lips – 2 g | 100% Natural Formula which Provides 12H Moisturization* | Free From Harmful Chemicals & Made Safe Approved
- Herys 4% Aha Bha Underarm Roll On | with 2% Lactic Acid, 1% Mandelic Acid, 1% Salicylic Acid | Prevents Odour, Reduces Pigmentation | for Radiant Underarms, 50Ml
- BARBIE Doll and Accessories, Crib Playset with Latina Doll & Accessories (Multicolor)
- Royalbox Meditating Buddha Statue For Home Decor Idol Decorative Showpiece – 17 cm (Polyresin, Gold)
- Himalaya Hydrating Aloe Vera Face Wash 200 Ml
- Blue Heaven Brow Perfect Eyebrow Enhancer Pencil & Styler, Ash Grey, 0.30 g
- Samsung 34-inch(86.8cm) Ultra WQHD 2K Odyssey OLED G8 Gaming, 175 Hz, 0.1ms Curved Monitor, USB Type -C, Smart TV, Height Adjustable Stand, AMD FreeSync (LS34BG850SWXXL, Black)
- One Store Self Adhesive 12 cm Wall Sticker (Pack of 14)
- Tior Polyester Fit and Flare Knee-Length Dress | Dresses Girl Frock for Kids|
- pTron Bassbuds Indie in-Ear TWS Earbuds w/ 10mm Drivers, 45Hrs Playtime, Dual HD Mic & AI-ENC Calls, Custom EQ, Mobile App, Bluetooth V5.4 Earphones, Voice Assistant, Type C Charging & IPX5 (Gray)
- NIVEA Lemon and oil 500ml Body Wash| Shower Gel with Scent of Lemon and Care Oil | Pure Glycerin for Instant Soft & Summer Fresh Skin|Microplastic Free |Clean, Healthy & Moisturized Skin
- Small Table Fan, Mini USB Desk Fan, Strong Airflow & Quiet, USB Powered, 3 Speeds Wind Small USB Fan for Desk, 360° Rotatable for Home Office Table Desktop (4 Inch)
- UV Protection Arm Sleeves with Thumb Holes, Nylon Sun Protection Hand Cover for Running and Cycling, Unisex
- True Elements Raw White Sesame Seeds 150gm – 100% Clean and Natural White Til | Safed Til Seeds for Eating | Raw Seeds | Versatile Ingridient | Everyday Essentials Indian Spices
- Shoe Washing Bag for Washing Machine – Sneaker & Sports Shoes Safe Cleaning Bag with Hidden Zipper, 360° Microfiber Protection, Reusable Laundry
- Saina Violets SVPRINCESGOLDEN Chiffon Printed Nose Piece (Black)
- Orient Electric Grace Pro 20W LED Batten| 2000 lumens Bright Light Output| LED tubelight for Home| Sleek & Stylish Design| Non-breakable Polycarbonate housing | Pack of 2
- BEARDO DeTan Face Wash for Men, 50ml | Glycolic Acid,Niacinamide & Coffee | Helps to Reduce Tan,Reduce Dark Sports & Pigmentation | Exfoliates & Hydrates for Smooth & Oil Free Skin
- CrossBeats Clip M01 AI Wireless Mic for YouTube Video Recording | iPhone 15/16 |Type C |Vlogging,Content Creation for iOS and Android,Collar Lavalier Lapel Bluetooth Mic Wireless Microphone(2026 New)
- DOVE Intense Repair Nourishing Shampoo (1000 ml)
- Axe Dark Temptation Shower Gel, 250 ml (Pack of 2)
- Nature Purify Anjeer Figs 1KG | Anjir Dried Figs Zero Added Sugar & Preservatives Dry Fruit
- CostarMatter 17-Stage Shower Head Filter for Bathroom, Hard Water Softener for Shower and Home, Multi-Mode Water Softener for Bathroom, 360°Steerable, 2 Filter-Cartridge
- FEELSO FE-15 PRO abs shower and tap filter for hard water with 15 stage Hard Water Softener Cartridge – Universal Shower Head Water Softener (Chrome FE-18 + 2 Cartridge)
- Lifelong Grooming Kit for Men, 13-in-1 Trimmer All in One | 1 Year Warranty | 90Mins Runtime, Rechargeable, Hair Trimmer for Men, Nose, Ear, Beard & Body Trimmer, Waterproof, 7 Length Settings,Black
- Honeywell Safes & Door Locks – 5103 Medium Steel Security Safe with Hotel-Style Digital Lock, 0.83-Cubic Feet, Black
- Cortina Polyester 150GSM – Long Crushed Emboss Floral Printed Light-Filtering (60-70% Room Darkening) Curtains for Bedroom, Office, Living Room & Hallway (Pack of 2,) (Navy Blue, 7FT)
- Lloyd 1 Ton 5 Star Inverter Split AC (5 in 1 Convertible, 100% Copper, Anti-Viral + PM 2.5 Filter, White with Graphic Design, GLS12I5FWBEV)
- Haier Gravity Series 1.6 Ton 5 Star AI Climate Control Smart Split AC (5460 Watts, HEXA Inverter, Copper, Fabric Finish, Wi-Fi, 4-Way, HD Filter, Cools at 60°C-HSU19G-MZAIM5BN-INV, Morning Mist)
- HIKVISION 2MP Eco HD 1080P Night Vision Bullet Outdoor Wired CCTV Camera for 2MP & Above DVRs, White
- Amazon Basics 4-in-1 Hub Multiport Adapter, USB Hub with Aluminium Shell, 1 x USB 3.0 & 3 x USB 2.0 for PC, MacBook, Mac mini, iMac, Tablet, and Mobile Phones
- Samsung Galaxy A17 5G (Blue, 6GB RAM, 128GB Storage) | 50 MP No Shake Camera | Gemini Live | Circle to Search | Super AMOLED | Corning Gorilla Glass Victus | 7.5mm Sleek | AI
- Samsung Galaxy A36 5G (Awesome White, 8GB, 128GB) | Gemini Live | Awesome Intelligence (AI): Circle to Search, My Filter, Object Eraser | 4nm Snapdragon Processor | Flagship Grade Camera
- Samsung Galaxy A06 5G (Black, 4GB RAM, 128GB Storage) | 50MP Dual Camera | 4 Gen OS Upgrades | IP54 Rating | Voice Focus
- Samsung Galaxy A07 5G Smartphone (Black, 6GB RAM, 128GB Storage) | 120Hz Refresh Rate | Massive 6000mAh Battery | 50MP True Dual Camera | 6 Gen OS Upgrades | Knox Vault
- Samsung Galaxy S25 FE 5G Smartphone with Galaxy AI (White, 8GB RAM, 512GB Storage), 12MP Front Camera, ProVisual Engine, Long Battery Life
- Samsung Galaxy A56 5G (Awesome Olive, 8GB, 128GB) | Metal Frame | Gemini Live | Awesome Intelligence (AI): Circle to Search, Instant Slo-Mo, Auto-Trim, Object Eraser | Flagship Grade Camera
- Samsung Galaxy A17 5G (Blue, 8GB RAM, 256GB Storage) | 50 MP No Shake Camera | Gemini Live | Circle to Search | Super AMOLED | Corning Gorilla Glass Victus | 7.5mm Sleek | AI
- Samsung Galaxy A36 5G (Awesome Lavender, 12GB, 256GB) | Gemini Live | Awesome Intelligence (AI): Circle to Search, My Filter, Object Eraser | 4nm Snapdragon Processor | Flagship Grade Camera
- Samsung Galaxy A07 5G Smartphone (Light Violet, 6GB RAM, 128GB Storage) | 120Hz Refresh Rate | Massive 6000mAh Battery | 50MP True Dual Camera | 6 Gen OS Upgrades | Knox Vault
- VIREO Jaipur Silk Multicolour 12×12 inch Cushion Cover Set of 5 pcs- 026
- Upto 80% Off On Mr Bowerbird Men’s Clothing
- 70-78% Off On Amante Women Innerwear & Clothing
- Samsung Galaxy A26 5G (Awesome White, 8GB, 128GB) | Awesome Intelligence (AI) | Circle to Search | Gemini Live | FHD+ sAMOLED Display | 50MP OIS Camera | IP67 Rated
- Samsung Galaxy S25 FE 5G Smartphone with Galaxy AI (Navy, 8GB RAM, 512GB Storage), 12MP Front Camera, ProVisual Engine, Long Battery Life
- Herbal Active++ Double Power Liquid Mosquito Vaporiser Refill Mosquito Vaporiser Refill No Kerosene Oil Poison Free Non- Toxic Chemical-Free (45ml,Pack of 3)
- Amazon Solimo Granite Finish Fry Pan with Glass Lid | Induction Base | PFOA Free | High Temperature Resistant Exterior Coating | 22 cm | Grey
- Lloyd 1.5 Ton 3 Star Fixed Speed Window Ac (Copper, White With Silver Deco Strip, GLW18C3YWSEA)
- Lifelong 2 Burner Gas Stove Top for Kitchen – Manual Ignition Cooktop Modern Glass Stove for Modular Kitchen, ISI Certified & Compatible with LPG – 1 Year Manufacturer’s (Black, LLGS10)
- AIRODO Neem Bathroom Air Freshener Assorted Blocks|Mixed Fragrance|30 Days Long Lasting (4 x 50g)
- GRAPHENE Holi Cap Premium Curly Afro wigs Clown Joker Malinga Cap Unisex Funky Hair Wig For Kids & Adults Holi Party Accessories Halloween Funny Wigs For Party (Pack Of 1)
- Head & Shoulders BARE Anti-Dandruff Shampoo, Pure clean, Sulfate-Free, Silicone-Free, Dye-Free, Gentle shampoo, 400ml
- Bata Men’s Slip-on Fisherman Sandal
- Portronics Power Plus Advanced Mini Router UPS for 12V DC WiFi Router Broadband Modem, Router UPS Power Backup During Power Cuts, Discharge Protection, Portable UPS(Blue)
- Parachute SkinPure Body Lotion with Vitamin C & Virgin Coconut Oil | Brightening Daily Moisturizer for Glowing Skin | Long-Lasting Hydration | Chemical-Free | Safe for All Skin Types | 400 ml
- Stainless Steel Kitchen Rack Stand Container Organizer Storage Shelf Holder Trolley Basket for Spice Boxes Utensils Dishes,2-Tier, 38.1Dx25.4Wx15.2H cm Large,Silver,Tiered Shelf (NHSP)
- Tokyo Talkies Women’s Slim Fit Cropped Trousers | Stretchable Trousers| Mid-Rise
- ADISA Kids Backpack Toddler Bag Back Pack Plush Cartoon for Girls and Boys 1-5 Years
- Havells Luna Striker LED 3W Pink Ceiling Light Energy Efficient WIDEST 7 Colour Option Perfectly FITS in Junction Boxes Powder Coated Polycarbonate HOUSING,60 Lumen Per Watt 6500K
- Aarika Girls Casual Wear Blue Colour Floral Print Polyester Co-ord Set
- MARKWELL100% Food Grade Premium Plastic Refrigerator Water Bottles For Fridge Set Of 3, 1 Litre (3)
- Ant Esports MP320C – Control Gaming Mouse Pad-XL-Extended Large with Stitched Edges, Waterproof Non-Slip Base for Gaming & Office – Black
- Pigeon Inox Plus 700 ml Steel Bottle (Pack of 4, Silver)
- HUG ‘n’ FEEL SOFT TOYS – 18 cm Blue Penguin Plush Toy | Cute Stuffed Animal for Kids, Boys & Girls | Ultra Soft, Huggable & Cuddly Toy for Birthday, Baby Shower & Valentine
- Amazon Solimo Non-Stick Kadai with Glass Lid | Granite Finish | Induction Base | PFOA Free | High Temperature Resistant Exterior Coating | 22 cm | Grey
- Halonix 10W B22 LED Cool Day Light Bulb, Pack of 10
- Motivational Time Marker Water Bottle with Straw and Flip Top Lid, Transparent Plastic Drinking Bottle with Carry Handle
- JAYMUKESH & CO. Glass Oil Dispenser Bottle Set with Pour Spout and Funnel, Clear Kitchen Oil Bottle (Oil Bottle & Scraper)
- SheNeed Maximum UTI Pain Relief | Fast relief in as little as 20 minutes of UTI Pain | Burning & Urgency | Targets Source of Pain – 60 Capsules
- Flavour Foodie Chia Seeds 1kg- Natural Hydrator for Summers | High Protein & High Fibre Seeds for Eating | Resealable Jar Pack | Premium Grade | Superfood for Smoothies, Salads & Baking
- OPEN SECRET Premium California Badam – High Protein Dry Fruit, Fasting Vrat Special Almonds (2 x 0.5 kg)
- Yogabar Multigrain Energy Bars, 30 Bars | Healthy Diet with Fruits, Nuts, Oats and Millets | Gluten Free and High Protein Crunchy Granola Bars | Packed with Chia and Sunflower Seeds
- ISILER Small Desk Fan, 1200mAh Portable USB Fan with 3 Speeds Airflow, Small Personal Fan with 180° Adjustable Tilt Angle, Cooling Fan for Home, Office, Dorm
- Reelay mee 12 L Light Weight, Polyester Backpack for Jr/Sr KG kids – 2727 (R Blue)
- Inditrust 2 in 1 Plastic Funnel Can Spout for Oil | Water | Fuel | Petrol | Diesel | Gasoline for Cars | Bikes | Trucks
- Havells Glamax 9W B22 WiFi LED Smart Bulb with Music Sync Function, Compatible with Amazon Alexa and Google Assistant (16M Colours)
- Furniture Café Wooden Kitchen Wall Shelf with 3 Tiers & Mug Hooks – Spice Rack and Storage Organizer for Jars, Condiments, and Utensils Brown)
- CIR Soft Body Cleansing Wet Bed Bath Wipes for Adults | Body Sponging | Extra Large, 10 Wipes/Pack (Pack of 8), 80 Wipes, White, One Size
- Lifelong Percussion Massage Gun | Full Body Massager for Pain Relief | Rechargeable Cordless Deep Tissue Massage Machine | 6 Specialised Heads for Use at Gym, Home & During Travel
- ULTRAFAST UF-HAG2000 Professional 2000W Hot Air Gun Dual Temperature Heat Settings 350℃- 550℃ Corded Heatgun for Wrapping Paint Removal Wire Shrinking Crafting
- AirCase Tizum 2nd Gen Stylus/Digital Pen for Apple iPad and Touchscreen Devices with Palm Rejection, Tilt Sensor, Compatible with iPad, iPad Pro, iPad mini, iPad Air, Precise Writing+Drawing (White)
- ZEBRONICS Zeb-Jaguar Wireless Mouse, 2.4GHz with USB Nano Receiver, High Precision Optical Tracking, 4 Buttons, Plug & Play, Ambidextrous, for PC/Mac/Laptop (White+Grey)
- Go Desi Meetha Paan Mouth fresheners, Desi Mints, Refreshing Mouthfreshener, Mukhwas, Box of 40 Sachets
- Bigmuscles Nutrition Real Mass Gainer [ Rich Chocolate]|Lean Whey Protein Muscle Mass Gainer|Complex Carbohydrates,|1000 Calories|Reduces Muscle Breakdown|Boosts Metabolism, 1 count, 1000 grams
- Bigmuscles Nutrition Karnage Pre workout (60 Servings, Sex On the Beach) | Pre-workout Supplement Supports to Improve Focus, Strength, Energy and Pump, Banned Substance Tested, Dope Free, 300g
- JBL Go 3 Wireless Portable Bluetooth Mini Speaker, Small Speaker with Pro Sound, Vibrant Colors with Rugged Fabric Design, Lightweight IP67 Waterproof, Type C Interface (Without Mic, Black)
- Van Heusen Analog Watch – For Women
- Geonix Vista V2 Smart Projector | 1080 HD Resolution, Rotatable Design, 150 ANSI, Screen Mirroring, 3 Watts Speaker | Home & Office Use (White)
- Puma Softride Vital Move Women’s Running Shoes
- Car Sqaure Beige Black Faux Leather Neck Rest For Xuv 3XO
- Ant Esports GP110 Wired Gamepad, Compatible for PC & Laptop Computer (Windows 10/8 /7) / PS3 / Android
- ZEBRONICS Zeb-V19Hd 18.5 Inch (46.99 Cm) Led Monitor with Supporting Hdmi, Vga Input, Hd 1366 X 768 Pixels, 16.7M Colors, Glossy Panel, Slim Design & Wall Mountable, Black
- Ant Esports MK3400 V3 Pro Mechanical Pro World of Warship Edition Wired RGB Gaming Keyboard (Black)
- Plantex Digital Safe Locker for Home/38 Litre Locker Box for Home Jewellery/Tijori for Office with Fingerprint Sensor & Emergency Key/1 Year Warranty By Plantex (Black)
- Boat EnergyShroom PB331 (Magsafe) 10000mAh Magnetic Wireless Powerbank, 15W Wireless & 22.5W Wired Charging for (iPhone 16, 15, 14, 13 & 12, Android & Other Qi Enabled Devices) (Ash Black)
- pTron Studio Sports Wireless BT Gaming Over-Ear Headphones, 30MS Low-Latency for Thrilling Gaming Experience, RGB Lights, Boom HD Mic w/AI ENC, 60Hr Playtime, Punchy Sound, Type-C Fast Charging(Black)
- Cello Aluminium Non Stick Grill Pan Square Black- Gas Stove Compatible Only , Maroon
- Crompton Energion HS 1200 mm BLDC Ceiling Fan with Remote Control | BEE 5 Star Energy Rating | ActivBLDC Technology | Anti-Rust | Superior Air Delivery | 5 Year Manufacturer Warranty | Opal White
- French Connection Analog Women’s Watch (Dial Colored Strap)
- Pigeon by Stovekraft Cruise 1800 watt Induction Cooktop With Crystal Glass,7 Segments LED Display, Auto Switch Off – Black
- WILD BUCK Wild Pre-X4 Hardcore Pre-Workout Supplement Powder with Creatine Monohydrate,Arginine AAKG,Beta-Alanine,Explosive Muscle Pump,Caffeinated -For Unisex[40 Servings,Watermelon Twist],4.25 grams
- Samsung 8 kg, 5 star, AI Control, AI Eco Bubble, Wi-Fi, Digital Inverter, Motor, Fully-Automatic Front Load Washing Machine (WW80T504DAX1TL, Hygiene Steam, Inox)
- Orgatre MoodBliss Creamy Matte Long Lasting Bullet Lipstick for Women | Intense Colour, Keeps Lips Moisturised | Non-Drying | Highly Pigmented Non-Transfer Formula | Enriched with Almond Oil (Chestnut Swirl, 3.2 gm)
- PARK AVENUE Sportz Style Deodorant Deodorant Spray
- Boult Audio Z40 True Wireless in Ear Earbuds with 60H Playtime, Zen™ ENC Mic, Low Latency Gaming, Type-C Fast Charging, Made in India, 10mm Rich Bass Drivers, IPX5, Bluetooth 5.3 Ear Buds TWS (White)
- Havells Gatik Pro 400mm Pedestal Fan| 120 Ribs Guard for Safety| Smooth Oscillation| Heavy Base| ISI Marked | 2 Year Warranty | Grey
- Gear Invent 19″/34L Large Water Resistant School Bag/Casual 4 Compartment Backpack/Daypack/Travel Backpack/Kids Bag for Boys/Girls – Black
- Yardley London Gold Deodorizing Talc| Fresh Woody Scent| Masculine Fragrance| Body Talc for Men| 250g
- Boat 2025 Launch Aavante 2.1 1600D / Orion Plus, Dolby Audio, 160W Signature Sound, 2.1CH Wired Subwoofer,Multiple Ports & EQ Modes, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- MILTON Pro cook Granito Non Induction Fry Pan, 18 cm, Burgundy, Flame Safe, Dishwasher Safe, Food Grade, Metal Spoon Friendly, Non – Stick, Bakelite Handle, 2 Years Warranty
- Carrier 2 Ton 3 Star Wi-Fi Smart Flexicool Inverter Split AC (Copper, Convertible 6-in-1 with Wi-Fi with Geo-Fencing,Smart Energy Display, 2026 Model, ESTER EDGE Gxi WiFi-CAI24EE3R36W0, White)
- Clinic Plus Strength & Smooth Shampoo, Fenugreek Protein + Hibiscus for Hair Strengthening and Smoother Hair, 650 ml
- COSTAR Wireless Door Bell Kits Chime for Home Office with LED Light 150 Meter 500 Feet Operating Range 57 Ringtones 4 Levels Volume, 1 Receiver and 1 Push Button IP44 Waterproof (Pebble T311)
- NIVEA Derma Skin Clear Toner (200ml), Cleansing and Hydrating, Salicylic Acid Toner Enriched with Niacinamide to Rebalance and Remove Impurities, For Blemish-Prone Skin
- Cello Travel Star Pastic Insulated Water Jug | Inner Stainless Steel Jug | Hot & Cold | Easy to Carry | 5 litres, CLO_WJUG_TRVL Star_5L_WBLUE, White & Blue
- Solimo Plastic Checkered Jar Container, Set Of 18 (6 Pcs X 250 Ml Each, 6 Pcs X 500 Ml Each, 6 Pcs X 1000 Ml Each), Blue | Kitchen Organiser | Bpa Free | Stackable
- Biotique Morning Nectar Flawless Skin Moisturizer Lotion L Prevents Dark Spots, Blackheads And Blemishes L Visibly Flawless Skin L Nourishes And Hydrates Skin L All Skin Types L 190Ml
- atomberg Efficio Exhaust Fan 200mm (8 Inches) | BLDC Motor | 20W | Low Noise | 1600 RPM | Ideal for Bathroom,Kitchen | Easy to Clean | Installation-Square Cut (245mm) | 2 Years Warranty (Gloss White)
- Surf Excel Matic Top Load Liquid Detergent 3.2 L Refill, Designed for Tough Stain Removal on Laundry in Washing Machines – Mega Pack (Pack of 2)
- uppercase Cargo 74cm(Large) Check-in Trolley Bag Dualtone Spinner Hardsided Luggage Secure Combination Lock Scratch-proof Surface Mesh ConviPack Suitcase for Men & Women 2000 Days Warranty(Yellow)
- Blue Star 1.5 Ton 5 Star, 60 Months Warranty, Wi-Fi Smart Inverter Split AC (Copper, Convertible 5 in 1 Cooling, AI Pro, DigiQ Hepta Sensors, 4 Way Swing, IE518ZNURS, White)
- GRAPHENE Dual Electric Holi Pichkari 2ltr Blue Backpack Water Big Tank Squirt Automatic 1Extra Rechargeable Battery High Pressure Spray Gun Long Throw Pool Parties Kids Boy Girl 1Pkt (100 Balloons)
- Havells Decorative Bulb-ORION G125FC SMOKE 4W 2000K E27 LAMP
- NutriGlow Advanced Organics Anti Pollution Sunscreen SPF50 PA+++ For Non Greasy Daily Moisturizer With Broad Specrtrum For Dry, Damage and Tan Free Skin, All Skin Types, (100 ml)
- MYFITNESS Peanut Butter Chocolate Spread Crunchy 510g | 23g Protein & 9g Fiber | Tasty & Healthy Nut Butter Spread for Breakfast & Snacks | Cholesterol Free | Zero Trans Fat | Crunchy Peanut Butter
- Brut Sport Style ALL-IN-ONE Shower gel for Hair & Body | Body Wash for Men| Authentic Fragrance 500ml
- Palmolive Soft Rose&Peony Aroma Alluring Love Body Wash For Women&Men|Mood Boosting Fragrance|Brightening|For Youthful,Hydrated Skin|No Paraben&Silicone,Ph Balanced,Body Wash Shower Gel 250Ml
- Amazon Basics Polyester Gym Duffle Bag with Shoe Compartment | 3-in-1 Versatile Bag for Gym, Travel, and Sports | Detachable Shoulder Strap | for Men & Women | 31L (Black Grey)
- Happilo Premium Arabian Dates Pouch 500 g (Pack of 2) | Arab Khajur or Khajoor | 100% Naturally Dried | No added Preservatives | Vitamins & Minerals Rich | Soft Chewy Texture & Sweet Caramel Taste
- Orient Electric Comforter Collection 11 fin Oil Filled Radiator | Advanced S-Shaped Fins |2900W Power| with PTC Fan Heater| 3 Heat Settings | 2 Years Warranty, Black
- Clinic Plus Strong & Long Shampoo 1 L|| With Milk Proteins & Multivitamins for Healthy and Long Hair – Strengthening Shampoo for Hair Growth
- Wild Stone Ultra Sensual, Forest Spice and Musk Soaps for Bath, (Pack of 6, 100gm each) | Grade 1 soaps | Refreshing Bath Soap for Men | Skin-Friendly and Energizing
- Larah by Borosil Silk Series Bali Opalware Dinner Set with Vision Glass | 35 pcs for Family of 6 | Microwave & Dishwasher Safe | Plates & Bowls | Crockery for Dining & Gifting | Floral Pattern
- Crompton Energion Hyperjet 1200mm BLDC Ceiling Fan | Point Anywhere Remote Control | BEE 5 Star Rated Energy Efficient | Superior Air Delivery | Anti-Rust | 2 Year Manufacturer Warranty | Matte Black
- Nisha Nature Mate Henna Based Hair Color Powder Without Ammonia Natural Hair Colour for Women & Men 10gm Pack of 10 (Original Black)
- Crystal Tribottom 160Mm Casserole with Glass Lid + 225Mm Fry Pan with Glass Lid
- Zebronics Wireless Keyboard & Mouse Combo, 104 UV-Coated Keys, ₹ Key, 12 Multimedia Keys, Retractable Stand, 4 Button Mouse, 1600 DPI, High Precision, USB Nano Receiver (Companion 116, Black)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- National Rifle Association of India is associated with which sport?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 24th February 2026
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- In 2024, who became the youngest person to win two Oscars?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- Which director won his first directing Oscar in 2024?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Who became the 17th Indian to score a century in Test debut?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- The iconic Air India building at Nariman Point was handed over to which state government?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 24th February 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 24th February 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato