Pages
- Best Laptops Deals March 2026
- Best Smart Watches March 2026
- Mobiles
- Amazon Deals & Offers for March 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 16th March 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Whirlpool 1.5 Ton 3 Star, Magicool Inverter Split AC (MAGICOOL 15T 3S INV CNV S5K2PP0, Copper, Convertible 4-in-1 Cooling Mode, HD Filter White)
- KILLER Men Flats Sandal (Grey , 6)
- Humidifier With Colorful Light For Room, Bedroom, Office, Car (Grey), 300 ML
- Wipro Garnet 3 W Slim COB Downlight for False Ceiling | Cool Day White (6500K) | Ceiling or Cabinet Light with Adjustable Optics | Pack of 1
- Campus Sutra Men’s Shirt for Casual Wear | Spread Collar | Long Sleeve | Regular Fit | Button Closure | Cotton Shirt Crafted with Comfort Fit for Everyday Wear
- PHILIPS 9W LED Tubelight, Pack of 2, (Astra Line)
- Max Women Cotton Blend Solid Regular Fit T-Shirt
- TWF Thin Crust Pizza Flour, 1 kg x 2, Flour 00 alternative (2 kg, Pack of 2)
- Slovic Head Massager for Scalp & Shampoo Brush with Soft Silicone Brush | Hair Massager for Hair Growth | Ideal for Dandruff Prevention, Oil Control, Blood Flow, Scalp Massage & Cleaning
- Sounce 4-Port USB 3.0 Hub for PC – High-Speed Aluminum USB Hub Compatible with PC, MacBook, Mac Pro, Mac mini, iMac, Surface Pro, and XPS. 4-Port High Speed USB Hub with Aluminium Shell
- Boldfit Postpartum Belt After Delivery Slim Belt for Women Belly Fat Maternity Belts After Delivery Abdominal Belts post Deliveries Pregnancy Tummy shaper for Women Slimming High Waisted Body Shaper
- Eveready 9W LED Bulb, Cool Day Light (6500K), B22 Base, Energy-Efficient, 4kV Surge Protection, Long-Lasting Durability – Pack of 12
- Stainless Steel Socket Adjustable Universal Multi Function Wrench Spanner Set Tools 9mm to 32mm Works, Hand Tools (Set of 2 Piece)
- Wipro 3 Way Multiplug Adaptor with 1 Universal Sockets |Inbuilt Surge Protection & Power supply Indicator | Compact & Light weight | 6Amp Multiplug socket for Home, Office | Pack of 1 (White)
- Nivia Snake 2.0 Running Shoes for Men, Lightweight Mesh Upper, Durable Rubber Outsole, Breathable & Cushioned Athletic Sports Shoes for Running, Training & Gym Workouts
- MarwarBites California Almonds 500gm| Badam Giri | High in Fiber & Boost Immunity | Real Nuts | Gluten Free & Zero Cholesterol | Natural Dry Fruits Pack
- Del Monte Tomato Ketchup Spout Pack, 900g
- WOSCHER AutoVac Pro High Power Auto Car Vacuum Cleaner for Deep Cleaning, Hand Held Portable Car Vacuum with DC 12V, 140W Vacuum Motor & Powerful Suction 5000PA, Black
- aqueria Multi Active Underarm Roll On | 5.5% AHA BHA, Niacinamide – Aqua Fragrance Deodorant Roll-on – For Men & Women (100 ml, Pack of 2)
- Acerpure Chill Neo1.5 Ton 3 star 4800W AC5IPG61.5TN3W48W 7 in 1 Convertible, Ice Blast Mode, 4 way swing, Cooling @ 58 degree
- Eveready Base B22D 7-Watt LED Bulb (Cool Day Light)
- Dabur Vatika Naturals Anti Dandruff Shampoo – 640 ml | 7 Natural Herb Extracts | Contains Lemon, Methi & Tea Tree Oil | Exfoliates Flaky Scalp for Dandruff-Free Hair | Everyday Shampoo for Women & Men
- Orient Electric Moonlite 6W LED Down Light, Cool White Light, Round, Pack of 1, Recessed Ceiling LED Light, Suited for 3 inch Junction Box (Aluminium) (6W, Pack of 1)
- Safari Punch Laptop Backpack Bag for Men & Women, School Bag for Boys & Girls, Ideal for Office/School/College, 3 Compartment Backpack with Rain Cover, Bottle Holder & Organizer
- Workout Grip Pads Ergonomic Hand Grip Strengthener with Quick-Release Mechanism, Suction Cup Design, Multicolor
- GROVANTI ORGANIC Disinfectant Surface Cleaner Citronella (5 L) Citronella (5 L)
- 6 Pcs Round Paint Brush Set for Watercolor, Acrylic & Oil Painting – Nylon Bristles, Wooden Handles – Art Brushes for Beginners & Professionals
- Lifelong Electronics ROAR Projector with 2 Mics | Booming 20W Speakers | Cricket Commentary, Karaoke Party & Room Cinema | 1080P & 4K Ultra HD Support | All Android OTT Apps | Ultra Bright 150” Screen
- Pierre Cardin President Premium Fountain Pen | Luxurious Black Lacquer Finish Body with Golden Trims & Nib | Free Ink Converter & Cartridges | Ideal for Festive & Corporate Gifting
- Nilkamal Verona High Back Mesh Office Chair with Headrest|Adjustable Height and Armrests|Adjustable Lumbar|Chair for Home, Desk, Study|Black
- CrossBeats Blaze B24 Bluetooth Soundbar 24W, Gaming RGB Lights, AUX, Bluetooth, USB, FM & TWS I Fast SnapCharge Battery, Multiport Connectivity, BT Speaker for TV, Mobile, PC, Laptops, Tablets Black
- Wipro Garnet 20W LED Bulb for Home & Office |Cool Day White (6500K) | B22 Base|220 degree Light coverage |4Kv Surge Protection |400V High Voltage Protection |Energy Efficient | Pack of 1
- Portronics Toad 103 Wired Optical Mouse with 2400 DPI, Plug & Play, Ambidextrous, Hi-Optical Tracking, 1.5M Cable Length, 30 Lakhs Click Life, Ergonomic Mouse for Comfortable All-Day Grip (Black)
- MILTON Costa 1000 Pet Water Bottle Set of 2, 1 Litre Each | Airtight & Leakproof Stainless Steel Lid | Unbreakable, BPA-Free, Reusable Plastic Fridge Bottles for Home, Office, School, Travel
- BELLAVITA Sunscreen – SPF 50 PA++++ Water based Hydrating Sunscreen (50 ml)
- WildHorn 30.7L Water Resistant 3 Compartment Backpack for Men/Women I Travel/Business/College Bookbags.
- Nike Woman Deodorant Spray Pack of 3 – Honey, Oud & Musk Long Lasting Fragrance Body Spray for Women | 24H Freshness | 200ml Each
- TEC TAVAKKAL Slide Toy Race Duck Track Set, Funny Automatic Stair-Climbing Ducklings Cartoon Roller Coaster Escalator Toy with Flashing Lights & Music
- Dabur Gulabari Shower Gel – 250 ml | 99% Pure Glycerine | Gentle Bodywash | Cellulite beads for Exfoliation | 0% Parabens & Soap | No Silicones | With Exotic Damask Rose & Organic Jojoba Oil
- Goyal’s 360 Degree Rotating Musical Dancing Toy with Attractive Multi Color Flashing Lights (Revolv Girl)
- Ching’s Secret Hakka Noodles Masala, 100g, Easy To Cook, Meal Kit, Cooks in 4/5Mins, 1 Pouch Serves 4, Pack of 5 Single Use Pouches
- sounce Black iPhone Charger and Headphones Adapter Splitter,MFi,C…more
- Puma Mens Tychonic Sneaker
- Bajaj Splendid 120TS 1200 Watts Tempered Glass Induction Cooktop With Tact Switch | Stove Comes With 7 Pre-Set Menus | Digital LED Display | 1 Year Warranty 【Black & White】
- Mustela Baby Body Wash and Shampoo with Avocado 100ml – Head to Toe Wash for Bath | Baby Shampoo | Gentle Cleansing Gel with Vitamin B5
- Mustela Baby Sunscreen SPF 50, 100ml | Sunscreen for Kids & Newborn (From Birth On) | Broad Spectrum UV Protection | Water Resistant | Sensitive Skin
- Kitchen Cleaner Spray for Oil & Grease Stain Remover All-Surface Non-Toxic & Non-Flammable Magic Degreaser Powerful Kitchen Cleaning Liquid with Fresh Scent 500 ml
- Skillofun Wooden Alphabet Blocks, Multi Color
- Nayasa Lego Print Stack N Store Big 1, Small 2 | Plastic Storage Boxes With Lid | Side Handle | Stackable Boxes | Can Be Used For Multipurpose Storage | Strong And Durable Quality | Yellow
- WildHorn Laptop Backpack for Men/Women I 34 L Capacity I Waterproof I Fits upto 15.6 inch Laptop
- Ant Esports KM1410 Wired Gaming Keyboard and Mouse Combo, RGB LED Backlit, 25 Keys Anti-ghosting Water Resistant Membrane Keyboard, Carbon Black, Upto 3600 DPI RGB Gaming Mouse.
- WildHorn 26L Laptop Backpack for Men/Women I Waterproof I Travel/Business/College Bookbags Fit 15.6 Inch Laptop
- JIVO Mustard Kachi Ghani 1 Litre (Pet Bottle) + Organic Long Grain Basmati Rice 1 KG Mustard Oil PET Bottle (2 x 0.5 L)
- aqueria Sunscreen – SPF 50 PA++++ Oil Control Brightening Multi-Active French SPF | 2% Niacinamide, Salicylic Acid (100 g)
- iBELL SM1515 Sandwich Maker with Floating Hinges, 1000Watt, Panini/Grill/Toast (Black)
- Toy Imagine Rechargeable Karaoke Mic with Speaker | Wireless Mini Portable Bluetooth Mic with RGB LED Lights | Singing Musical Toy & Birthday Gift for Kids, Boys, Girls & Adults
- Baidyanath Amla Juice|Pitta-Balancing, Immune-Boosting Juice For Cough, Cold & Seasonal Illnesses|Antioxidant & Vitamin C Rich|Cold-Pressed|Supports Weight Management|1000 Ml
- 3D Cat Figurine Crystal Ball Lamp, Cat-Light Lamp with Wooden Base, Gifts for Cats Lovers, Stuff for Animal Lovers, Birthday Christmas Mothers Day Temed Items for Women Lovar
- BAKE KING Essence for Cake Making Combo of 6 Flavours Mango, Blueberry, Vanilla, Chocolate, Banana, Butterscotch Flavour Essence Vanilla Essence Cake Baking, Muffins, Milkshakes, Dessert 30 ML
- hindware smart appliances Atlantic Xceed 5L 3Kw Instant Water Heater With Copper Heating Element And High Grade Stainless Steel Tank, Wall Mounting
- HP 620 FHD Webcam, Wired USB 3.0 Type-A, FHD 1080p, 2 x Noise-reducing mics, Auto Focus and Zoom, 360° Swivel, Adjustable Field of View, Zoom Certified, 1-Year Limited Warranty, Black, 6Y7L2AA
- Gizga Essentials Hard Drive Case Shell, 6.35cm/2.5-inch, Portable Storage Organizer Bag for Earphone USB Cable Power Bank Mobile Charger Digital Gadget Hard Disk, Water Resistance Material, Black
- SONATA Women of Steel Analog Watch – For Women 8182NL02
- BELLAVITA Perfumed Bathing Soap Bar For Men|3X100gm|Helps in Relaxing & Cleansing Skin| (3 x 100 g)
- LG Smart Choice, 322 L, 3 Star, Frost-Free Smart Inverter Double Door Refrigerator (GL-S342SDSX, Dazzle Steel, Convertible with Express Freeze)
- LG 8 Kg 5 Star Smart Inverter Technology Fully Automatic Top Load Washing Machine (T80VBMB4Z, Turbodrum, Auto Prewash, Stainless Steel drum, LED Display, Smart Diagnosis, Middle Black)
- Bajaj Frore Neo 400 MM Wall Mount Fan | Wall Fan For Kitchen & Home | Smooth Oscillation | 100% Copper Motor | High Air Delivery | 3-Speed Control | Rust Free | 2-Yrs Warranty 【Blue】
- Dabur Gulabari Pure Rose Soap 150g (Pack of 4) | Moisturizing Bathing Soap for Radiant Glowing Skin & Body | Glycerine & Niacinamide | Long Lasting Fragrance | For Men & Women
- True Elements Quinoa 1kg – Gluten Free Breakfast | High Protein and Fibre | 100% Wholegrain Cereal | Best for Weight Loss | Quinoa Seeds | Diet food for Weight Management
- FRONTECH Premium 2.0 Channel USB Powered Speakers – 1.5W x 2 Output, AUX Input, Foam Edge, 1-Year Warranty (SPK-0003-Blue)
- Portronics Beem 440 Smart LED Projector with 720p HD Resolution, Rotatable Design, Built-in Streaming Apps (Netflix, Prime Video, Hotstar), 2000 Lumens, Screen Mirroring, 3 Watts Speaker (White)
- FRONTECH True Wireless 5 Watt Output Multimedia Speaker with Bluetooth 5.0 and Mystic RGB Lighting with 800 mAh Battery, Mobile Holder and Karaoke (SW-0219)
- LG Essential Series, 0.8 Ton 2 Star, Smart Inverter Split AC (Copper, Convertible 6-in-1 Cooling, Faster Cooling & Energy Saving, HD Filter with AntiVirus Protection, New BEE Rated, AS-Q11KNVE, White)
- ILIFE V20 Robotic Vacuum Cleaner with Latest SoF Navigation, @5000Pa Po…more
- LIBERTY Women Heels Sandal (Yellow , 3)
- Colorbot Helix BLDC Ceiling Fans 1200mm | BEE 5 Star Rated | 370 RPM | Savings up to 65% | Remote Control (Boost, Timer, LED, Reverse Mode) | 4 Years Warranty (Arctic White)
- Cirio Pizza Sauce, 14.11 oz ℮ 400 g, 12 Pack
- DENVER Acne Clear Facewash With Kaolin Clay and Neem Face Wash (100 g)
- Amazon Basics USB Gamepad with Turbo Mode | Dual Vibration | PS3 & PC Support | X Input & Direct Input | Wired Controller with Ergonomic Design | 1m Cable | Black
- NutriGlow Hydrating Rice Water & Ceramides Facial Cleanser, Sulfate Free, Paraben Free, Deep Moisturising All Skin Types For Men And Women (100 ml) Pack of 3
- anker wireless charger, powertouch 5 for galaxy note 5, s7/s7 edge/s6/s6 edge/s6 edge+, nexus 4/5/6/7, nokia lumia 920, lg optimus vu2, htc 8x/droid dna and more- Black
- Rozi Decoration Unicorn Hanging Swirl Decorations for Kids Boys Girl’s Birthday Party Decorations Multicolor- Pack of 6 Piece Paper
- The Indian Garage Co Men Slim Fit Checkered Full Sleeves Spread Collar Casual Shirt
- Egg Boiler Electric Automatic Off 7 Egg Poacher For Steaming, Cooking, Boiling And Frying, (350 Watts,Multicolor)
- Bikano Ghar ki Gujia 400g
- Santoor Fresh Skin Aloe Vera & Lime Bathing Soap with Nourishing & Anti-Aging Properties| For Smooth & Soft and Younger-Looking Skin| For All Skin Types| 125g, Pack of 6
- Sunsilk Luscious Thick & Long Shampoo 650 ml || with 3% KERA-PROTEIN COMPLEX – for Thicker, Bouncier Hair
- Upto 81% Off On Mochi Women Footwears.
- HAMMER Nova in Ear C Type Earphones Wired with Mic,13mm Driver, in-line Control, Metallic Built, Powerful Bass, Comfortable & Lightweight (Green)
- Yogabar 26g Protein Milk Shake, with 26g Protein, No Added Sugar – Ideal for Daily Protein Consumption, Workouts, Sports & more – Pack of 6 (250ml, Double Chocolate)
- HAMMER 3.5mm Wired Earphones with Mic & in-line Controls, 13mm Dynamic Drivers, Clear Sound Compatible with Phone, Laptop & Tablet (Black)
- Beardo Whisky Smoke Perfumed Luxury Soap for Men, 75g | Deep cleanses skin pores | Repairs broken skin and Reduce Hyperpigmentation | Refreshing Fragrance all day long
- Hisense 1.5 Ton 3 star Inverter Split AC(Copper, 5-in-1 Convertible with Intelligent 4 modes, PM 2.5 filter, Anti corrosion, AS-18TR4R3E1, White）
- Pure Source India Ceramic Aroma Oil Diffuser Gift Set with 10ML Relaxing Oil & Tealight Candles | 97 Burner for Home Fragrance & Relaxation | Ideal for Gifting & Home Décor (Navy Blue)
- Samsung Galaxy Watch8 Classic (46mm Bluetooth, Black) with 3nm Processor | Dual GPS | Sapphire Glass & Stainless Steel | 5ATM & IP68 | BP, ECG, IHRN & Vascular Load Monitoring | Anti-oxidant Index
- REO By Havells BLDC 1200MM Ceiling Fan “Fixed Price Always” | Air Flow: 220 CMM| Speed: 350 RPM| Reverse Rotation Mode| Timer Setting| 2 Year Door Step Warranty By Manufacturer (Energex, Cocoa Brown)
- iQOO Z11x 5G (Titan Black, 6GB RAM, 128 GB Storage) | Dimensity 7400-Turbo Processor | 7200 mAh Battery Smartphone | Powered by OriginOS 6
- ATTRO My Lunch 2 Layer Plastic Lunch Box Comes with Fun Galaxy Astro Print, 1 Detachable Tray, 1 Small Container & 1 Spoon Ideal for Kids BPA Free 1590ml+70ml- Blue
- Everyuth Naturals Nourishing Cocoa Body lotion 200ml for men & women | 48Hr Hydration | Deep Moisture Care for Dry Skin | Enriched with 100% Natural Almond Milk | Smooth, Radiant & Healthy Looking Skin Care
- Bajaj DMH90 Neo 90L Desert Air Cooler | Powerful 90ft Air Throw for Large Rooms | Big Ice Chamber & High-Speed Cooling | Inverter Compatible | 1 Year Warranty【White】
- Flat 60-65% off on New Balance shoes
- Solimo Modular Plastic Storage Container With Airtight Lid | BPA-Free Plastic | Microwave Safe | Dishwasher Safe | 1.2 Litres | Set of 6 (Blue)
- DORAYA Women Maxi Blue Midi/Calf Length Dress
- Cello Induction Cooker Blazing Venus | Induction Cooktop | Power On/Off Push Button | Compact and Portable | Multi-Purpose Use | Non-Fire Cooking Technology | Black
- HP DeskJet Ink Advantage 2338 All-in-One Printer, Print, Copy, Scan, Hi-Speed USB 2.0, Up to 7.5/5.5 ppm (Black/Color), 60-Sheet Input Tray, 25-Sheet Output Tray, 1000-page Duty Cycle, Color, 7WQ06B
- Hitachi 1.5 Ton 5 Star Xpandable+ Inverter Split AC (100% Copper, Smart Display, 4-Way Swing, ice Clean, Dust Filter, 5400STXL RAS.G518PCCIBT, White)
- Biotique Bio Sandalwood Sunscreen Ultra Soothing Face Lotion, SPF 50+ |Ultra Protective Lotion| Keeps Skin Soft, Fair and Moisturized| Water Resistant| For All Skin Types| 190ml
- Yardley London| Shower Gel| Floral Essence| With Natural Floral Oils Of Iris & Violet| No Parabens| No Silicones 500ml
- Midea 2026 Model 1.5 Ton 5 Star Split Inverter Convertible 6-in-1 with …more
- Samsung Galaxy Watch8 (40mm, Bluetooth, Graphite) with 3nm Processor | Dual GPS | Sapphire Glass & Armor Aluminum | 5ATM & IP68 | BP, ECG, IHRN & Vascular Load Monitoring | Anti-oxidant Index
- Red Lemon Vogue Laptop Shoulder Bag 13-13.3 inch slimcase Waterproof Laptop Carrying Case
- TE-A-ME Vanilla Matcha Tea Powder – 50g (33 Servings) | Make Delicious Macha Vanilla Latte | 100% Natural | Ceremonial Grade | Flavoured Matcha
- Carrier 1.5 Ton 3 Star Flexicool Inverter Split AC (Copper, Convertible 6-in-1 with Smart Energy Display, Insta Cool, Auto Clean, PM 2.5 Filter, New BEE rated, ESTER EDGE Gxi-CAI18EE3R36F0, White)
- POCO C85x (Emerald Green, 64 GB) (4 GB RAM)
- Aristocrat Combat Check-in Trolley Bag, 73 Cm Large Hardside Luggage | 8 Wheels, Combination Lock | Polycarbonate | 5 Year International Warranty | Blue
- Scott International Men’s Rich Cotton Regular Fit Striper Polo T-Shirt |
- Fastrack Men Perfume Travel Pack (3 x 20ml) – Compact Fragrance Set for Rakhi Gifting
- ABCD Rs. 70 Cashback on Merchant Scan & Pay of Rs.300
- Himalaya Skin & Nail Health Gummies | Pack Of 30 | For Healthy, Glowing, Youthful Skin & Nails | With 5 Essential Vitamins|Gelatin-Free Fruit Based Gummies | 100% Vegetarian
- Puma Womens Lightstorm WNS Sneaker
- Crompton Laser Ray Smile 4 Feet LED Batten 20W Cool Day Light | Pack of 1 | Slim, Energy-Efficient Tubelight Light for Home & Office
- POLYCAB Celestia 5-Star 10L Water Heater (Geyser) | 5-yr tank & 2-yr product warranty | Temperature Control Knob | Enhanced Safety, Rust Proof Tank | Efficient Heating【White】
- The Earth Store 1000 ML Plastic Oil Dispenser Transparent Cooking Oil Pourer for Kitchen Leakproof Sauce Vinegar Liquid Dispenser
- L’Oréal Paris Hyaluron Moisture Shampoo Refill With Hyaluronic Acid For 72 HR Hydrated Hair, 500ml
- Ambrane Wired in Earphones with in-line Mic for Clear Calling, 14mm Dynamic Drivers for BoostedBass™, 3.5mm Jack, Multi-Functional Controller (Stringz 38 Lite, Black)
- Park Avenue Premium Men’s Soaps for Bath – Cool Blue | 125g (Pack of 4) | Menthol & Mineral Energizer | Grade 1 Soap | For All Skin Types
- Scott International Shirt for Men | Solid Full Sleeves Wrinkle Free Mens Shirts | Cotton Formal Shirts for Men Regular Fit | Stylish Mens Shirt | Plain Shirt for Man
- Scott International Men’s Regular Fit T-Shirt
- Premium Aluminum Folding Towel Rack in Bathroom, Towel Rod for Bathroom with Hooks and Hangers, Towel Holder in Bathroom, 24 Inches
- The Sleep Company Orthopedic GRID Mattress | Doctor-Recommended Support for a Healthy Back | Patented SmartGRID Technology | Medium Firm | 10-Year Warranty | King Size Bed Mattress | 78x72x8
- Bergner 17 Pcs Ramadan Set, Triply Cookware Set, Consumes Less Oil, Healthy Cooking, Complete Kitchen Set, Even Heat Distribution, Induction Compatible, Gift Set for Marriage/Anniversary
- Moi Soi Matcha Green Tea Powder | 100% Pure Ceremonial Grade | Rich Umami Flavour | 1.5g x 5 Sticks | Pack Of 1
- Apple 2026 MacBook Neo 13″ Laptop with A18 Pro chip: Built for AI and Apple Intelligence, Liquid Retina Display, 8GB Unified Memory, 256GB SSD Storage, 1080p FaceTime HD Camera; Indigo
- TIMEX Analog Watch for Men with Round Dial & Water Resistant Man’s Wrist Watches
- Scott International Men’s Cotton Regular Fit Denim Shirt | Denim Full Sleeve Shirt | Shirt | Jeans Shirt | Denim Casual Shirt | Shirt | Shirt Stylish
- Signate Car Engine Oil for Petrol, CNG and Diesel Car 5L, Synthetic Engine Oil for Cars, Anti-Wear Car Engine Oil for Reduced Maintenance Cost, 5L
- Cello Aqua Leaves Dazzle Series Opalware Dinner Set, 37 Pieces, Service for 6, White, Extra Large (Model: CLO_OPLWR_DZZL_AQLVS_DS_37PCS)
- Prestige 500W Nexus Mixer Grinder with 3 Stainless Steel jars|1200ml Wet Jar,800ml dry jar, 400ml chutney jar|3 Super-efficient Blades|3 motor setting|Sturdy Handles |2 Yrs Warranty|White & Rose Gold
- Haldiram’s Mawa Dry Fruit Gujiya – 400g – Traditional Holi Sweet
- Haldiram’s Coconut Dry Fruit Gujia 400g | Gujiya Sweets | Indian Mithai Festive Sweet Gift Box | Mithai for All Occasion- Holi Special
- FASHION COLOUR Mercury Retrograde 18 Eyeshadow Palette (18gm) | Perfect for casual and dramatic looks | Does not crease or smudge | Long Lasting | Easy-to-blend & build Up |
- Dabur Glucoplus-C Instant Energy Glucose Powder (Lemon), 400g | Replenishes Energy | 20% More Glucose | With Vitamin C & Calcium
- Story@Home 16 x 16 inch Polyester Cushion Cover for Bedroom/Living Room (Pack of 5 Pieces, Brown)
- Acer 1.5 Ton 3 Star Split AC (5-In-1 Convertible Cooling Modes, AiSense Technology, ArcticWrap Cooling, PM 1.0 Microbacterial Filter, High Ambient Temperature of 55 °C – AR15AS3IS1HLE25)
- IFB 8 Kg 5 Star, DeepClean® Technology, AI Powered, WiFi, Fully Automatic Front Load Washing Machine (SENATOR GXN 8012 CMS, PowerSteam®, 9 Swirl, Steam Refresh, Inbuilt Heater, Eco Inverter, Grey)
- Bosch 10kg 5 Star Anti Stain & AI Active Water Plus Fully Automatic Front Load Washing Machine with Built in Heater (WGA252ZSIN, Pretreatment, Iron Steam Assist & Allergy Plus, Silver)
- Clazkit Water Bottle Stainless Steel Sports/Fridge Bottle with Leak Proof Lid | Single Wall | For Home, Office, Gym, Travelling | Lightweight | BPA Free | 1000ml | Silver)
- ORJILO 5 PCS Microfiber Car Duster Kit Interior & Exterior Car Cleaning Detailing Tool Scratch & Lint Free, Pollen Removing Extendable Long Handle Duster for Car & Motorcycle car (Car Duster Kit)
- Aristocrat Polyester Solid Pattern Fitch Dft 62 Softshell Inlineskatewheel Suitcase/Trolley Bag (Red, Medium), H-30 Centimeters
- Fire-Boltt Aero TWS Earbuds Custom EQ, Wireless Bluetooth 5.4, Music & App Support, 50H Playtime, Fast Charging Case, 50ms Low Latency for Gaming, Touch Controls, IPX4 Waterproof, Clear Calls – Black
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- National Rifle Association of India is associated with which sport?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 16th March 2026
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 16th March 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 16th March 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato