Pages
- Best Laptops Deals April 2026
- Best Smart Watches April 2026
- Mobiles
- Amazon Deals & Offers for April 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 20th April 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Syska HD1625 Hair Dryer (1600 W, Grey)
- Fire-Boltt Ninja Phantom Smart Watch 1.83” Display, Transparent Clear Body Design, Bluetooth Calling, 120+ Sports Modes, Voice Assistant, AI Outfit Watch Face Smartwatch for Men & Women Stealth White
- Gillette Fusion 5, Shaving Razor For Men | With Beard Shaping Back Blade | 5 Blades For Your Perfect Shave | Styling Back Blade For Your Perfect Beard Shape
- Horlicks Chocolate Nutrition Drink, 1 kg Jar
- Boat Nirvana X TWS,Knowles Dual Drivers, Hi-Res Audio LDAC, App Support,4Mic ENx,Dual Pair,Spatial Audio,Fast Charge, Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Cosmic Onyx)
- Jade & Julie Women Pajama Set
- Butterfly Magneto Mixer Grinder with 4 Jars | 1000W TorX23 Motor | Contra Curv Jar & Blade Design | Specially Annealed Jars| Ink Blue
- aqueria Sunscreen – SPF 50 PA++++ Brightening & Hydrating Multi Active French SPF | In-Vivo/In-Vitro Tested (100 g)
- The Old Natural Calmag-Z | Calcium, Magnesium, Zinc | 16 Ayurvedic Herbs | Joint & Immunity (60 Tablets)
- Cadlec Breeza 1200 MM with 3 Year Warranty Ultra High Speed Ceiling Fan (Smoke Brown | Pack of 1)
- Samsung 189 L, 5 Star, Digital Inverter, Direct-Cool Single Door Refrigerator (RR21H2H25RZ/HL, Midnight Blossom Red, Base Stand Drawer, Single Touch Defrost, 2026 Model)
- Crompton Laser Ray Smile 20W LED Batten |4 feet Slim Batten for Living Room & Bedroom | Energy Efficient Tubelight for Home | BIS Approved | Cool Day Light (6500K) (Pack of 2)
- Sunfeast YiPPee! Magic Masala, Long, Non-Sticky Instant Noodles | With Real Vegetables 12 in 1 Pack | 720 gram/840g/ 871.2 (12 unit *72.6)(weight may vary)
- Bumpers Moisturising 99% Water Baby Wipes with Lid, Aloe Vera & Vitamin E | Extra Thick & Moist | Alcohol & Paraben free | pH balanced & Hypoallergenic | 72 Counts
- Zebronics Zeb-Cronus Premium Gaming Cabinet with Mirror Finish Tempered Glass On Front,Tempered Glass On Side & 4 x120mm Rainbow Double Ring LED Fans
- Colgate Gentle UltraFoam Ultra Soft Bristles Manual Toothbrush for adults, 2 Pcs, Soft Bristles for Superior Clean, Assorted
- Urbane Home Pack of 3 Cotton Hand/Face Towels for Men & Women | Easily Washable | Workout Gym Napkins for Men | Pocket Towel – Dark Blue-Green & Golden
- Protective Sunscreen Lotion SPF 50+ PA+++ | Non-Sticky Matte Brightening Formula | UVA UVB Protection | Suitable for All Skin Types | Daily Use Moisturizing Sunscreen | 50ml
- Lloyd 1.5 Ton 3 Star Inverter Split AC (6 in 1 Convertible, Cools Even at 52°C, Turbo Cool, Anti Corrosion Coating, 100% Copper, White, GLS18I3FWGSC)
- Whisper Super Absorbent Period Panty, 12 M-L Pants, 360 Degree Leakage Protection* for Heavy Flow, Panty like Fit, Full back Coverage, Absorbs Heavy Gushes, Silky Soft, Comfortable Feel
- Sunfeast Farmlite Oats & Almonds Cookies 300gm
- Kwality Multigrain Chocos Moons and Stars 375g | Delicious Breakfast Cereal for Kids | Fortified with Iron & Vitamins | Wholesome & Crunchy Snack
- MOOV Instant Pain Relief Cream Regular Cream (3 x 50 g)
- Mueller Reusable Cold/Hot Pack, 4.75-inch x 6-inch Small
- Aqualens 10H Monthly Disposable Contact Lenses – (6 Lens/Box) (-4.00)
- Copper Water Bottle with 2 Glass | 1 Liter Leak Proof Reusable Copper Drinking Bottle | Ayurvedic Copper Bottle for Daily Hydration, Home, Office & Travel
- Ant Esports Eclipse Mid-Tower Computer Case/Gaming Cabinet – Black & White | Support ATX,M-ATX,M-ITX | Pre-Installed 4 x 120mm ARGB Fans
- Microfibre Cleaning Cloth Roll, 25 x 25 cm, Grey, Multipurporse Cleaning Uses Pack of 20, Quick Tear-Away Design
- SEREKO Sunscreen SPF 50 PA++++ Crème Gel | Zero White Cast, Blue Light + UVA/UVB Protection | Quick Absorbing, Non-Greasy, 24H Hydration | For Men & Women | All Skin Types – 50ml
- Samsung 189 L Direct Cool Single Door 5 Star Refrigerator with Base Drawer (Camellia Blue, RR21H2H25CU/HL)
- Pioneer Car Dash Camera VREC-H120SC Impressive1296p |2MP camera |Super Compact design|Wide Field of View | Wi-Fi |G-sensor |Emergency Recording| microSD Card support Upto 128GB|Super Capacitor|(Black)
- Lifebuoy Lemon & Aloe Bodywash | 12hr deo fresh | Fights body odour germs| 750ml
- Everyuth Naturals Purifying Neem Antibacterial Neem and Tea Tree Oil Hydrated, Clear Face Wash (150 g)
- PHILIPS 9W B22 LED Bulb Warm White, Pack of 2
- Larah By Borosil Moon Milky Way Dinner Set – 21 Pcs, Opal Glass Dinner Plates & Bowls Crockery Set for Dinning, White
- Car Sqaure Beige Black Faux Leather Neck Rest for Hyundai Creta Old(2014-2019)
- Non-Greasy Rice Water Body Lotion with Ceramide
- Pepe Jeans Men Trunks
- RAMSONS Mycastillo Black Amber Eau de Parfum – 60 ml (For Men & Women)
- Charminar Long Grain Rice, 5 kg | Ideal for Daily Cooking
- Manna Rolled Oats 1kg | Gluten Free | Old fashioned oats | Diabetic Friendly | 100% Wholegrain 1kg (Pack of 1)
- Gesto 10 Meter Rope Led Strip Lights – High Brightness Outdoor Lights Waterproof for Balcony,Home Decor,False Ceiling | RGB Strip Light for Diwali Decoration with Mode Change Controller (Multicolor)
- True Elements Steel Cut Oats 500g | Sugar Free Oats | Healthy Breakfast | 100% Wholegrain | Diabetic Friendly Oats | Breakfast Cereal
- Goldmedal Twiz 100 mm Mini Portable Fan| Desk Mounted| Type-C USB-Powered Rechargeable Battery with 8-9 Hours Backup| 3-Light Brightness Setting| Personal Fan for Home & Office | Easy to Carry (White)
- CADLEC Aquanix Electric Kettle (1.8 L, Silver)
- Reynolds JIFFY Gel 60 Ct Jar-Blue | Pens With Comfortable Grip | Gel Pens For Writing | Pen For Students & Office Stationery | 0.5 Mm Tip Size
- GET IN THE GAME PS4 and PS5 Controller THUMBGRIPS Antic Pattern (Vortex)
- BonKaso Square Slim Rain Shower Head 6 Inch – Stainless Steel, Chrome Finish, Wall Mounted, Long-Lasting, Rust-Free, Corrosion Resistant, Relaxing Spa-Like Bath Experience | Deluge
- Vertux Gaming Keyboard, Ergonomic USB Wired Mechanical Keyboard with Integrated Wrist Rest, Black Switches, RGB Backlit, 104 Anti-Ghosting Keys and 8 Multimedia Keys for PS5/PS4, Xbox One/X, Tungsten
- 18+ KamaSutra SkinFEEL Thinnest Condom for Men | Skin to Skin Sensation | Combo Pack of 10
- Saffola 25g High Protein Oats | 14g Fibre | 400g | Chocolate flavour | No Refined Sugar | With Almonds, Raisin, Pumpkin and Chia Seeds | Rolled Oats for Weight management & Muscle gain
- Fire-Boltt Rise Force Smart Watch 1.85” Display, Nylon–Fluoroelastomer Hybrid Strap, Rotating Crown, Bluetooth Calling, Dual Button Control, Metal Body Smartwatch for Men and Women Midnight Black
- ZEBRONICS-Transformer-M with a High-Performance Gold-Plated USB Mouse: 6 Buttons, Multi-Color LED Lights,High-Resolution Sensor with max 3600 DPI, and DPI Switch(Black)
- Granic Farms Premium Dried Blueberries Plum 500gm | Blueberries Plum | Whole and Unsweetened | Vegan and Gluten Free – Vitamin Rich | Low Fat Healthy Snacks | Dried Blueberries 500gm
- Tokyo Talkies Womens Co-Ord Set
- Parachute Advansed Cocoa Repair Body Lotion with Pure Coconut Milk & Cocoa butter, 100% Natural Moisturiser, 225ml
- Miduty Chelated Magnesium Bisglycinate (Glycinate) | 1000mg Supplement For Sleep, Stress, Muscle Recovery & Cramps | 400mg Elemental Magnesium | High Absorption with Vitamin B6 | 60 Veg Capsules
- JOTO Plastic 2 Pack Waterproof Phone Pouch Case Up to 7,IPX8 Underwater Phone Case Cellphone Dry Bag for iPhone 16 15 14 13 12 Pro Max Xs Max XR X 8 7 6S Plus SE/Galaxy S24 S23 S22 S21-Black & Clear
- AutoClean Rear Wiper Blade With Wiper Arm i20 Elite
- Maharaja Whiteline Speedmix Plus Hand Blender with Stainless Steel Blades | Long Lasting Performance with 175 Watts Motor | Detachable Plastic Foot | 2 Year warranty (Turquoise Blue & White)
- ZEBRONICS Zeb-companion 301 Wireless Standard Desktop Keyboard Co…more
- Sturlite Helo 10W LED Bulb| German Quality Certified With Advance CRI Technology| 15000 Hrs Rated Life and 900 Lumens Brightness| BIS and BEE Approved| B22 Base Energy Efficient Lighting – (Pack of 8)
- MIXOSAMulti Purpose Made In Japan Kitchen Scissors, food scissors,Premium Stainless Steel Solid Kitchen Shears for Meat, Seafood, Chicken, Vegetables, Herbs, BBQ, Bottle Opener (Black)
- Parachute Advansed Baby Gift Pack with New Born Baby Essentials| 100% Virgin Coconut Oil | Pack of 6 with Milestone Booklet
- Disco Ball, Disco Lights Party Light Sound Activated Party Lights with Remote Control
- SpinZ Black Magic Perfumed Deo For Women, With International Aerosol Fragrances For Long Lasting Freshness And 24 Hours Protection From Odour Causing Bacteria, 200Ml
- Boat Type C to Lighting Cable for 27W Fast Charging | 480 Mbps Data Transfer | 1.2 m (3.9 ft) Perfect Cable Length | Premium Nylon Braiding | Durable & Tangle-Free | with Silicon Tie (Arctic White)
- Gulabari White Rose Soap – 450g (150g x 3) | Moisturizing Bathing Soap for Soft, Glowing Skin for Skin & Body | Goodness of Almond Milk, Honey & Niacinamide
- Memory Foam Pillow, Contour Cervical Orthopedic Memory Foam Pillows Supports Neck Pain and Shoulder Pain for Sleeping, Ergonomic Cervical Pillow Neck Support Pillow for Side Back (Y2)
- Havells Mozel XP 1200mm Ceiling Fan, Best in Class Base Fan with High Air Delivery, Energy Saving & 100% Pure Copper Motor | 2 Year Warranty | Matt White
- LONGWAY Ventura 8 Inch 200 mm Energy Efficient Exhaust Fan | High Speed Powerful Motor | Noiseless Operation with Anti Dust Shutters |Suitable for Bathroom, Kitchen, Office | 2 Years Warranty (White)
- ASUS TUF A15 (2025), AMD Ryzen 7 7445HS,RTX 3050-4GB,75W TGP,16GB DDR5(Upgradeable Upto 64GB) 512GB SSD,FHD,15.6″,144Hz,RGB Keyboard,Windows 11,Graphite Black,2.3 Kg FA506NCG-HN199W, Gaming Laptop
- MILTON Curve 2500 Inner Stainless Steel Casserole, 2.15 litres, Light Green | BPA Free | Food Grade | Easy to Carry | Easy to Store | Chapati | Roti | Curd Maker
- MILTON Drift 1000 Stainless Steel Water Bottle 950 ml, Set of 3, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Halonix 2-in-1 Dimmable 9W,0.5W Multi Wattage Adjustable Light Led Bulb (Pack of 2), All Rounder led Bulb Base B22D
- Theskinmantra 13-13.3 inch (33cm) RastaPride Laptop Sleeve Case Bag for Apple MacBook/MacBook Air/MacBook Pro/Surface Book/Notebook Computer (Multicolor)
- ZEBRONICS ZEB-LPC2365 Laser Printer Toner Cartridge, 2650 Page Yield, Toner Powder& PCR, high-Resolution Blackness with Excellent Clarity and a Smudge-Free Output.
- Hummingbird Cushion Covers (16×16 Inch) Printed Square Covers Soft Decorative for Sofa/Chair/Bedroom (Pack of 2) Rose
- Sheopals Natural Face Wash | Brightening, Acne-Fighting & Deep Cleansing | Paraben-Free, Sulfate-Free, For All Skin Types – 100ml (Black tea Facewash)
- Surf Excel Easy Wash Detergent Powder7 kg | Superfine Washing Powder | Dissolves Easily & Removes Tough Stains | Suitable for all Washing Machines
- Blue Star CF3-300MPW Chest Type – Hard Top Freezer, 301 litres, White
- adidas Mens Astoundrun M Running Shoe
- Harpic Disinfect Toilet Cleaner PrEmium Quality Original Liquid Toilet Cleaner (5 L)
- Wipro 9W Bluetooth Enabled Smart Bulb B22 | 16 million Colours | White Tunable (Warm, Neutral & Cool White) | Dimmable | App-Control | Music Sync | Schedule & Scenes | Pack of 1
- Signoraware Round Plastic Dinner Set, 21 Pieces, Lemon Yellow
- Deco India Wooden TV Unit Wall Mounted for Wall & Living Room (Br…more
- Boldfit Kinesiology Tape for Physiotherapy Kinesio Tape for Sports Injury Pain Relief Muscle Tape for Shoulder, Wings, Arms, Ankle K Taping Waterproof Athletic Tape for Pain Support -2 Inch Beige
- Lenovo Slim Folio Case/Cover for Tab P11 2nd Gen with a Built-in Pen Holder (Suitable for Lenovo Tab P11 2nd Gen, Screen – 11.5 Inch, Storm Grey, [Auto Sleep/Wake Case], ZG38C04531)
- Parachute Advansed Cocoa Repair Body Lotion for Women & Men, 100%…more
- Fire-Boltt Newly Launched Aero Lite TWS Earbuds Custom EQ Wireless Bluetooth 5.4 Music & App Support 50H Playtime Fast Charging Case 50ms Low Latency for Gaming Touch Controls Brown
- ZEBRONICS CP100, 12 Pcs, Flexible Spiral Cable Protector, Durable Data Cable Saver, Protective Cable Cover for All Wired Accessories, for iPhone & Android Charging Cables, Set of 3 (Multi-Color)
- ZEBRONICS Zeb-V19Hd 18.5 Inch (46.99 Cm) Led Monitor with Supporting Hdmi, Vga Input, Hd 1366 X 768 Pixels, 16.7M Colors, Glossy Panel, Slim Design & Wall Mountable, Black
- Lifelong LLMC01 Electric Kettle (1.5 L, Black, Silver)
- Borosil Cookfresh 1.3L Tri-ply Stainless Steel Frypan with Handle | Gas, Induction Compatible | SS304 Food Grade Steel 20cm Frying Pan | Even Heat Distribution | Dishawasher Safe | 5 Year Warranty
- BeeBaby Soft Silicone Nibbler with Extra Mesh for Babies, Baby Fruit & Food Feeder, Anti Choking Fruit Pacifier, Teether for Infant, 100% BPA Free, 3 Months+ (Chewy – Pink)
- Aktion AK H02_WHT Safety Helmets Rachet Type, Color: Violet, Pack of 2, IS 2925:1984
- Himalaya Herbals Anti-Dandruff Hair Oil, 100ml
- Yardley London English Rose Luxury Soap, 100 G, Pack of 3
- Xiaomi 138 cm (55 inch) FX Pro QLED Ultra HD 4K Smart Fire TV L55MB-FPIN
- Milton Viva Tuff 1500 Water Jug, PU Insulated Inner Stainless Steel Hot & Cold Jug, BPA Free, Leak Proof, 1.3 Litre, Black, Ideal for Tea, Coffee, Water, Hot Beverages
- Acer EK-Series 60.45 cm (24 inch) Full HD LED Backlit IPS Panel w…more
- Cult Neo Boxing Gloves 10 OZ – Pro-Style Training Gloves for Sparring, Heavy Bag & Mitt Work – Premium PU Leather, Shock Absorbing Padding, Ergonomic Design with Wrist Support – Blue & White
- APPLE MGPG4HN/A Power Bank (White, Lithium-ion, for Earbuds, Lapt…more
- Fiama Body Wash Shower Gel Golden Sandalwood Oil and Patchouli, 250ml, Body Wash for Women & Men with Skin Conditioners for Soft and Luxurious Skin, Suitable for All Skin Types
- Panasonic 1.5 Ton 3 Star, New Star rated, Premium WiFi Inverter Smart Split AC (DustBuster Tech, Matter Enabled, AI, Higher Airflow, Copper Cond., 8in1 Convertible, 2-Way,PM0.1 Filter,CS/CU-SU18BKY3W,White)
- Diolty Floor Cleaner 10L Can | Neem Fragrance | For Tiles, Marble, Wood | Non-Toxic, Pet-Safe Liquid | Hand-Safe, Anti-Slip | Concentrated Cleaning Solution for Home & Office
- Wobbox Haldi Ceremony Decorations Items, Haldi Decoration Items, Haldi Mehandi wedding Decoration Items-FP3830, 1 banner,bunting banner,party props and balloons
- The Indian Garage Co Men Regular Fit Colorblocked Wind Cheater
- Biotique Bio Morning Nectar Visibly Flawless Serum (40ml)
- Clinic Plus Strength & Smooth Shampoo, Fenugreek Protein + Hibiscus for Hair Strengthening and Smoother Hair, 650 ml
- ANNI Designer Men Cargo Pants Cotton Solid | Cargo Pants for Men | Mens Cargo Trouser | Multi Pocket Cargo Pant Regular Fit | Casual Stylish Bottom Wear for Mens Comfortable Clothing
- Lakme Glycolic Illuminate Day Cream 50 g| Skin Cell Regeneration Cream & Reveals Even Toned Skin with Glycolic Acid
- Voltas Beko, A Tata Product 6.5 Kg 5 Star Semi-Automatic Top Loading Washing Machine (WTT65UNX/OK3I0I0W01, Blue, Pulsator wash technology)
- Larah by Borosil – Moon Series, Red Stella 21 Pieces Opalware Dinner Set, White
- Van Heusen Men Anti Bacterial Briefs – Colour Fresh, Moisture Wicking
- Gwan Japanese Rose, Aroma Oil for Home Fragrance | Best for Aromatherapy | Helps in meditation | Used in Diffusers, Candles, Air Fresheners, Soaps, Humidifier, Diffuser | Essential Oil 10 ml,
- Cotton Rope Balls for Dogs and Pets |Puppy Toys Small Rope Balls for Teething |Durable Chew Cotton Rope Balls |Pet Friendly Washable Dog Toy Rope Ball for Small and Medium Dogs (Green)
- Dogista Durable Big TUG Knotted Cotton Rope Toys for Teeth Cleaning and Chewing, Small & Medium Dog/Cat/Puppy (Multicolour).
- Noise Buds N1 Pro Truly Wireless Earbuds with Metallic Finish, ANC(Upto 30Db), 60H of Playtime, Dual Pairing, Instacharge(10 Min=200 Min), BT V5.3(Chrome Beige)
- Sky Jewel Unbreakable PET Water Bottle,Set of 3,1000 ml,Multicolor
- ZEBRONICS HAA1520C HDMI 2.0 Male to Male Cable, 1.5 Meter, 3D Compatible, 4K @ 60Hz, ARC, Strong & Durable, Compatible with TVs, displays, A/V Receivers, Blu-Ray Players, Computers, Playstation & more
- ZEBRONICS 180HB USB HUB, 3 Ports, USB 3.0, Transfer Speeds Upto 5 Gbps, Lightweight Design, Multi OS Compatible, Plug and Play
- ZEBRONICS ATC1 USB Type A to Type C Converter, USB 3.0, High-Speed Data Transfer, Backward Compatibility, Plug and Play, for Laptops | Smartphones | Compatible Devices
- DZert Ealephant Kids School Bag Soft Toy Plush Backpack Cartoon Bag Children’s Gifts Boy/Girl Baby/Decor School Bag for Kids (2-5 Years)
- Moon & Mount Dishwash Liquid Gel 1L – Lemon Fragrance, No Residue Grease Cleaner for Utensils, Tableware & Cookware
- OnePlus Bullets Wireless Z3 in-Ear Neckband with 12.4mm Drivers, 3D Spatial Audio,10 mins Charge for 27 hrs Playback, AI Call Noise Cancellation, 4 EQ preset, Dynamic bass Enhancement & BT5.4
- Polycab Wizzy Neo LED 2.0 1200mm BLDC Ceiling Fan with remote |BEE 5 Star Rated, Higher Air Delivery|LED Indicator,Reverse,Sleep and Breeze Mode,Free Installation |3 Years Warranty (Matt Brown Copper)
- Safari Luma Neo 8 Wheels 55cm Cabin Size Trolley Bag, Hard Case Printed Polycarbonate, 360 Degree Wheeling Carry on Luggage for Men & Women, Suitcase for Travel, Trolley Bags for Travel, Multicolour
- Safari Thorium Royale 8 Wheels 66cm Medium Size Trolley Bag Hard Case Checkin Polycarbonate Luggage, TSA Lock, Wet Pouch Organized Interior, Suitcase for Travel, Trolley Bags for Travel, Gun Metal
- Orient Electric Glacio 125L Commercial Air Cooler | High Air Delivery, 3 Speed Settings | High-Density Honeycomb Cooling Pads | Auto-Swing Technology | 1 Year Product Warranty by Orient | Grey
- Aristocrat Vortex Plus | Set of 2 Trolley Bag, 55+65 Cm, Small+Medium Hardside Luggage | 8 Wheels, Combination Lock | Polycarbonate | 3 Year International Warranty | Midnight Blue
- Gillette Mach 3, Shaving Razor For Men | Most Comfortable Shave | 3D Blade Technology | Metal Handle For Superior Grip
- T.T. Mens Titanic 100% Cotton Shrink Controlled Regular Fit Vest
- RR Signature Vento Fresh Luxura 150 mm Exhaust Fan For Kitchen, Bathroom | Silent, Compact Design, Easy Install | Thermal Fuse | High Speed 100% Powerful Copper Motor | 2 Year Warranty [Rose Gold]
- Dabur Babool Ayurvedic Toothpaste -700g (350g x 2) | For Strong Teeth & Healthy Gums | Helps in Cavity Protection, Fresh Breathe | All Round Protection
- Orient Electric Elfie Rechargeable Personal Fan | 90° Adjustable Airflow | 1800 mAh Battery | 4 Speed Modes | Quiet Operation | USB Type-C Charging | Compact Mini Fan (Beige)
- JioEyeQ Dashcam (2026) with GPS |1080p Camera | 140° Ultrawide FOV | AI Pedestrian Detection | 32GB Micro SD Included | Night Vision| Emergency Recording | Collision Detection | Built in Wi-fi & Mic
- Cello Opalware Dazzle Series Golden Arc Dinner Set, 18 Units | Opal Glass Dinner Set for 6 | Light-Weight, Daily Use Crockery Set for Dining | White Plate and Bowl Set
- Pigeon by Stovekraft Inox hydra 900ml pack of 3 Stainless Steel Drinking Water Bottle 900ml Flipper Cap – Silver (1 year Warranty)
- Apple Watch SE 3(2025) GPS 40mm Starlight Aluminium Case Starligh…more
- XIAOMI G Series 80 cm (32 inch) QLED HD Ready Smart Google TV wit…more
- HomeWiz plastic Oil Dispenser 1 Litre | Pack of 2 | Transparent, Leak-Proof, BPA-Free Oil Container for Cooking Oils & Vinegar | Kitchen accessories items for home | 2000ml |
- Clovia Bra Full Coverage Lightly Padded
- The Pant Project 60% Off
- Upto 75% Off On Beauty Products.
- Signoraware Plastic Square Dinner Set, White, 31-Pieces
- SignoraWare BPA Free Plastic Square Dinner Set | Microwave Safe | Unbreakable & Lightweight | Odor-Free | Great for Parties & Gatherings | Ideal for Regular Home Meals (Set of 24 pcs | White)
- SINGER Nutri Master 500 W Juicer Mixer Grinder (Nutricool | 2 Jar…more
- URBANSTAR 20T BENZO Model Kids Cycle (RED) 20T Roadster Cycle -Semi Assemble (Single Speed- Red-Rigid, Fork)
- Baidyanath Shankhapushpi Sharbat – 220 ml with Free Sharbat – 110 ml (Pack of 2)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 20th April 2026
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 20th April 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 20th April 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato