Pages
- Best Laptops Deals June 2026
- Best Smart Watches June 2026
- Mobiles
- Amazon Deals & Offers for June 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 6th June 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Engage XX2 Cologne Perfume Spray for Men 135ml | Fruity & Amber | No Gas Cologne | Long Lasting Premium Fragrance | Skin Friendly | Dermat Tested | Try Engage Amber Hues EDP
- Noise Buds N2 Pro Truly Wireless Earbuds with ANC (Up to 32dB), 70H Playtime, Dual Pairing, InstaCharge (10 Min = 200 Min), Bluetooth v6.0, Metallic Finish – Aurora Red
- Unibic Choco Kiss | Limited Edition Choco Filled Cookies | Chocolate Delight | Perfect Gift | 500Gm
- Parle Platina Hide & Seek Choco Rolls, 200 gram, Chocolate
- Kwality Muesli Jaggery, Fruits, Seeds & Crunch 400g | Goodness Millets Brown Rice & Oats | 66% Multi Grain Mix Natural Sweetener | High-Fibre, Multigrain Breakfast Cereal with Crunch & Nutrition | Natural sweetner Jaggery
- Americana Premium Bourbon Chocolate Sandwich Biscuits, 500g x 2 Packet = 1kg – Rich Creamy Filling, Crispy Cocoa Biscuits, Vegetarian Tea Time Snack
- Ariel Power Gel Liquid Detergent for Top Load & Semi Auto – 3.6kg with Lavender Fragrance | Removes 100 Dried Stains in 1 Wash | Faster Dissolving | Color Protection | At the price of Powders
- Parachute Advansed Cocoa Repair Body Lotion with Pure Coconut Milk & Cocoa butter, 100% Natural Moisturiser, 225ml
- Fiama Relax Hand Wash, 750 ml Refill Pack, Value Pouch, Lavender Oil & Ylang Extracts Handwash, for Soft & Supple Hands
- SpinZ Pristine Green Perfumed Aerosol Deo For Women, With International Fragrances For Long Lasting Freshness And 24 Hours Protection From Odour Causing Bacteria, 200Ml
- Halonix Bug Zapper Anti-Mosquito Racquet, Insect Killer Bat with Rechargeable 400 mAh Battery | Mosquito bat | Fly swatter | Orange
- Yogabar Unsweetened Almond Drink 1 ltr | Lactose Free | No Added Sugar |Gluten Free | No Preservatives | Barista Approved | Zero Cholesterol | Dairy Free| Source of Calcium & Vitamins | Almond Beverage Unsweetened
- Dabur Herb’l Clove Toothpaste – 600g (Pack of 2, 300gx2) | Cavity Protection Toothpaste | No Added Fluoride, Parabens & Triclosan | Helps Fight Bacteria & Pain
- Bru Instant | Aromatic Coffee From South Indian Plantations | Premium Blend of Robusta & Arabica Beans For a Rich Coffee Experience | 200g
- Portronics Ruffpad 8.5E Re-Writable LCD Writing Pad with Screen 21.5cm (8.5-inch) for Drawing, Playing, Handwriting Gifts for Kids & Adults,(Black)
- Portronics Ruffpad 8.5M Multicolor LCD Writing Pad with Screen 21.5cm (8.5-inch) for Drawing, Playing, Handwriting Gifts for Kids & Adults, India’s first notepad to save and share your child’s first creatives via Ruffpad app on your Smartphone(Black)
- Dabur Red Bae Fresh Gel – 600gm (300gm*2) | Fights Bad Breath, Cavity Germs and Plaque | 12hr Freshness | Activ Germ-Kill formula
- Welspun 120 TC Cotton Blend Bedsheet for Double Bed with 2 Pillow Cover | Skin Safe & Super Soft Queen Size Bed Sheet | (224 X 254 CM) – Ornate Brown | Harmony
- HOMEKART 220 GSM Reversible Microfiber AC Comforter/Duvets for Mild Winter | All Season King Size 3 Layered Quilted Blanket for Single Bed (150 cm x 225 cm, Floral, Beige & Brown)
- Robustt Top Load Fully Automatic Washing Machine Cover for 6 kg, 6.5 kg, 7kg & 7.5 kg (Grey) | Waterproof & Dustproof Polyester Fabric with Zipper | Protection Cover | 59 x 59 x 86 cms
- GEONIX Vigor R7 Wired Gaming Mouse with 1200 DPI, PVC Cable, 3 Buttons, Center Click, 1 Year Warranty (Black Red)
- HP Smartchoice OmniBook 5 OLED (Previously Pavilion), Snapdragon X Processor (16GB LPDDR5x, 512GB SSD) 2K, 14”/35.6cm, Win11, M365(1yr)* Office24, Silver, 1.35kg, he0014QU, Next-Gen AI Laptop
- Oshea Colors HD Matte Finish & Highly Pigmented Long Lasting Creamy Lipstick | Lightweight Formula Enriched with Castor Oil, Shea Butter & Jojoba Seed Oil | Free from Paraben – (Peachy Lips 11) 1.2g
- NIVEA MEN All in 1 Charcoal Face Wash 100 g | With Charcoal, Mulethi & Mint for complete detox in Summer | 10 X Vitamin C Effect for Radiant Skin | For detoxified and refreshed skin
- Acer PopGo Wireless Gaming Mouse | 2.4G+BT5.4 Dual Mode | 500mAh Rechargeable Battery | Adjustable DPI Upto 6400 | Silent | 6 Buttons+Scroll Wheel | 10m Range | Windows, Mac Compatible – Rose Red
- Dabur Vatika Naturals Anti Dandruff Shampoo – 640 ml | 7 Natural Herb Extracts | Contains Lemon, Methi & Tea Tree Oil | Exfoliates Flaky Scalp for Dandruff-Free Hair | Everyday Shampoo for Women & Men
- Roar 12 Portable Bluetooth Speaker, 12W Deep Bass, 8H Playtime, Type-C Fast Charging, BT v5.3, TWS Stereo Pairing, FM Radio, USB/SD Card, Handsfree with Built-in Mic (Midnight Sun)
- boAt Aavante 2.1 300, 40W Signature Sound, 2.1 CH w/Wired Subwoofer, Multiple Ports, EQ Modes, Remote Control, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- Cult Impact Edge Deep tissue massage gun, Dual Hot and Cold therapy head, 3000mAh battery, 6-speed intensity, Silicone round head, Full body gun massager machine
- Wooden Magnetic Door Bell Chime – Brass Shopkeeper Entry Alert for Small Doors, Wall Mount Classic Sound Bell, Decorative Vintage Doorbell for Home, Office & Store Use
- WizToy Construction Toy Cars (3 Month Warranty) for 2,3,4,5 Year Old Boys, Girls Toddlers – Push and Go Construction Truck Toy, Pull Back Vehicles – 6 Pack Gift Set
- Purifying Neem Facewash 200ml(Pack of 3) | Mild Face Wash With No Harsh Chemicals, Soap & Paraben Free, Removes Dirt & Excess Oil For All Skin Type
- POND’S Youthful Miracle Hexyl Retinol Complex, Renew & Repair Day Cream 50g SPF 15 PA++
- Puma Men Smooth Walk Running Shoe
- Auric Skin Radiance for Glowing Skin 20 Tablets with Biotin, Amla, Pomegranate & Grape Seed Extract | Mixed Berries Flavour | Shine 365
- CP PLUS 2MP Full HD Wi-Fi CCTV Camera for Home with Motion Tracking | Smart Detection Suite | Night Vision | Cloud Recording | View & Talk | Supports OK Google | CTC Cyber Secure | CP-E25Q
- Ambrane Unbreakable 60W Fast Charging 1.5M Braided Type C to Type C Cable for Smartphones, Tablets, Laptops & Other Type C Devices, PD Technology, 480Mbps Data Sync (RCTT15, Black)
- BSB HOME Premium Cotton Elastic Fitted Bedsheets with 2 King Size Pillow Covers | Double Bed with All Around Elastic 180 TC Supersoft | (72″x78″,Green & Red)
- Savlon Moisture Shield Germ Protection Liquid Handwash Refill Pouch, 1500ml (Pack of 2)
- Wickedgud Whole Wheat Masala Noodles 240g (Pack of 4) x 2 | No Maida | No Palm Oil | Source of Protein
- WickedGud Korean Instant Noodles Fiery 2X Spicy Pack of 5 | Whole Wheat | No Palm Oil | 67g
- Wonderchef Acura Stainless-steel Electric Kettle | 1.5 L | Auto Shut-off | 360 Degree Swivel Base | Thermostat Control | Power Indicator | 1-year Warranty
- Ant Globe 10 Wired Optical Mouse with 1200 DPI, USB Connectivity, Lightweight Design, Durable 3 Buttons, Compatible with Windows/Mac/Linux White
- Philips 10-watt LED Bulb|3 Colors in 1 LED Bulb|Scene Switch Bulb for Home & Decoration|Color: Tunable White, Pack of 1, 10 w, b22d
- HP H250 Wireless Earbuds; Upto 80 Hours Playtime; Fast Charge; Water Resistant; Compatible with Tablets, Smartphones, PCs, and Other Devices with Bluetooth, 1 Year Warranty, Crème (AB3D7AA)
- Signoraware Opulent Non Stick Tadkapan 13cm | Ergonomically Designed Handle | Compact, Efficient & Stylish Tadka Pan | Ideal for Quick Tasks tadka for dal & Seasoning for Veggies (500ml | Steel)
- Pond’s Age Miracle Deep Action Night Cream – 50 gm
- Odonil Gel Pocket – 50g (10g X5) | Pack of 5 Assorted Fragrances | Infused with Essential Oils | Germ Protection | Lasts Up to 30 Days | Air Freshener for Bathroom, Toilet, Home & Office.
- Boat Rockerz 113, 40H Battery, Dual Pair, Fast Charge, ENx Tech, Stream Ad Free Music via App Support, Magnetic Buds, Bluetooth Neckband, Wireless with Mic in Ear Earphones (Ash Grey)
- Portronics Car Power 30 Dual Output Fast Car Charger with 30W Type-C PD & 30W USB, LED Indicator, Charging Adapter Compatible with Cars for iPhone & Android Smartphone, Smartwatch(Black)
- Loud Digital Alarm Clock for Heavy Sleepers, Large Display 24Hr Desk Table Clock with Time & Date, Magnetic Retractable Stand, Compact Study Timer for Students Bedroom Home Office Kitchen
- JO Lime Fresh Soap (Pack of 8), 150 gram
- Halonix Astron Star Base B22 12-Watt LED Bulb (Pack of 2, Cool White)
- Vaseline Colour+Care Kissing Red Tinted Lip Balm Stick 3g (Pack of 3)
- VASELINE Cloud Soft SPF 50 PA ++++ Light Moisturiser, 100 ml, for Soft and Bouncy Skin, with Ceramides & Hyaluron Moisture Fillers, Non-Sticky and Lightweight, Broad Spectrum Protection
- Lakme Powerplay Priming Matte Lipstick, Smooth Matte Finish, Lightweight Lipstick, Smudgeproof, Lasts 16hrs, Hydrates Lips, Garnet Punch, 3.6g (Pack of 1)
- CP PLUS 3MP Smart Wi-Fi CCTV Camera | 360° Pan & Tilt | CTC Cyber Secure Tech | View & Talk | Smart Detection Suite | Night Vision | Cloud Storage | Supports OK Google | CP-E35Q
- LG 185 L, 5 Star, Smart Inverter, Direct Cool Single Door Refrigerator (GLD1956ZAPI, Purple Ilan, Fit Max Chiller Tray, Base stand with Drawer & Runs on Home Inverter)
- HP Omnibook 3, Snapdragon X Processor, 45 TOPS (16GB LPDDR5x, 512GB SSD) 2K, WUXGA, IPS, 14”/35.6cm, Win 11, Office 24, Silver, 1.4kg, hz0026QU, FHD IR Camera, 42% Lighter mini GaN Charger, AI Laptop
- ASUS V400 (2026),Intel Core 3 100U (14th Gen),Intel iGPU,8GB/512GB,FHD,23.8″(60.45 cm),Windows 11,M365 Basic(1Y),Office 24,Black,5.46 kg,V440VAB-KBC3002WS,with Wireless Keyboard & Mouse,All in One PC
- nariya NEW LUNCHBOX SET WITH 3 CONTAINER 1 BOTTLE SPOON SET AND CASSEROLE 3 Containers Stainless Steel Office Lunch Box (1050 ml)
- Attro Uranus Stainless Steel Lunch Box with 1 Small Container & Spoon Eyecatchy Soccer Playing Print BPA Free Food Grade-700ml+160ml- Mint Green
- ATTRO Sip Star Plastic Water Bottle – 1000ml, Green, BPA Free, Leak-Proof, Durable Sports & Travel Bottle, Ideal for Gym, Office, School, Outdoor & Daily Use
- Puma Unisex-Adult Badminton Smash Sprint Indoor Shoe
- Navratna Gold Ayurvedic Cool Oil | Goodness of Almonds | Non-Sticky and Fresh Lily Fragrance | 500ml
- Pigeon 3L Instant Water Heater(Geyser)| Temperature Sensing LED Indicator| Rust & Shock Proof Body| ISI Certified | 2 Year Warranty| High Rise Compatible (White)
- GOBOULT Astra Truly Wireless in Ear Earbuds with 48H Playtime, Built-in App Support, 45ms Low Latency Gaming, 4 Mics ENC, Breathing LEDs,13mm Bass Drivers, TWS Ear Buds
- Dabur Badam Tail : Sweet Almond Oil | Rich in Vitamin -E for Healthy Skin , Hair and Body – 100ml
- Signate 20W50 Street Race Bike Engine Oil 1L, High Performance Engine Oil for Motor Cycle, Maximum Gear Protection & Efficient Performance Bike Oil (Pack of 3)
- Dabur Gulabari Rose Oil & Tea Tree Face Toner Mist & Rosewater with Salicylic Acid – 100ml | Treats breakouts, blackheads, and whiteheads | Tightens and Refines Pores | Alcohol free
- Ketley Gold Tea Premium & Strong Combo, 2kg
- Del Monte Foodcraft Spirali Pasta, Durum Wheat Semolina, 500g| No Maida | Authentic Italian Taste | High Protein & Fibre | Zero Trans Fat
- LAKMÉ Peach Milk Moisturizer Spf 24 Pa++, 200 Ml Lotion(Pack Of 2)
- ATTRO Sparkle Medium Stainless Steel Lunch Box 2-Piece Set – 800ml + 150ml – Leak-Proof, BPA-Free, Compact & Durable – Ideal for Kids, Office, Travel – Green
- Attro Dumbbell Water Bottle 2 Liter Plastic Bottle with Grip Handle Stylish Bottle for Gym Lover BPA Free, Food Grade, Leakproof- Green
- ATTRO Trio Meal Stainless Steel Lunch Box with 3 Partition, Microwave Safe, Airtight Leakproof Silicone Seal Lid, BPA-Free Food Grade Tiffin Box for Office School Kids – 600ml – Pink
- ATTRO Plastic Spider Shaker Bottle with Storage 300ml Protein Mixer Bottle with Compartment for Supplements, BPA-Free, Leakproof Gym Shaker Cup, Ideal for Workout, Gym, Travel Black
- Pampers Complete Skin Comfort Pants, Medium (M) 228 Count, Anti-rash blanket, Lotion with Vitamin E & Aloe Vera, 7-12kg
- Boat Airdopes Joy, 35Hrs Battery, Fast Charge, IWP Tech, Low Latency, 2Mic ENx, Type-C Port, v5.3 Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic(Jet Black)
- Fiama Gel Bar Celebration Pack with 5 unique Gel Bars, 125g (Buy 4 get 1 Free)
- Dabur Herb’l Activated Charcoal & Mint Toothpaste – Star Wars Pack (Black Gel)- 240g (120gx2) Combo Pack | For Whitening | Fluoride Free Toothpaste | Fights Plaque & Extrinsic Stains
- MILTON Hector 1000 Water Bottle, 1 Litre, Reusable Plastic Fridge Bottle, BPA Free and Leak Proof Bottles for Travel, Work, Pack of 1, Grey
- Yardley London Gentleman Classy Musk Body Perfume| The Elite Collection No Gas Deodorant Spray For Men| Men’s Body Perfume| 120Ml
- pTron Flick M2 Wireless Gaming Mouse w/RGB Lights, Precision Tracking, Dual Wireless Modes-BT & 2.4GHz, 6 Buttons, Thumb Support, Rechargeable, Ergonomic Design for Laptop, Smartphone, Tablet (Black)
- Crompton Dyna Ray LED Bulb | 7W | Warm White | B22 Base | 180 Degree Coverage | 4kV Surge Protection | 440V High Voltage Protection | Pack of 1
- Beardo Whisky Smoke Bourbon Perfume 50ml & Mariner Perfume 50ml Combo | Long Lasting Perfume For Men | Oriental, Woody, Leathery | Fresh, Aqua Notes | Gift Set | Rakhi Gift for Brother | Gift for boyfriend | Gift for Men | Gift for Brother
- Larah by BOROSIL Fluted Series Ageria Opalware Dinner Set | 19 Piece for Family of 6 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- Beardo The Ultimate 4 – Whisky Smoke, Bourbon, Godfather & Mariner Perfume Set for Men (20ml x 4) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Boat Airdopes Plus 311, Glass Design, ENx Tech, Fast Charge, 50 Hrs Battery, Stream Ad Free Music via App Support Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Ash Grey)
- Beardo Power & Fire Combo for Men- GodFather & Whisky Smoke Firebomb Perfume for Men (50ml x 2) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Pampers Premium Care Pant Style Baby Diapers M 20 Count | No Marks Design | Voted India’s #1 Softest Diaper | All in 1 diaper with 360 Cottony Softness
- Dove Serum Bar | with Nutrient Serum | Deep Nourish | 875g (125g x 7)
- Godrej No.1 Lime & Aloe Vera (150g), Pack of 9 – High TFM (Grade 1 Soap), Long-Lasting Fragrance
- Nescafe Gold Decaf Cappuccino Unsweetened Coffee, 120 g
- Pee Safe Comfort Period Panties | XL-XXL | 4 Panties | 360° Protection | 12 Hr Protection | Leak Proof | Overnight Comfort | Rash & Toxin Free | Seamless Fit
- Samsung Original Travel Adapter (15W, White)
- Revlon Super Lustrous The Gloss, Non-Sticky, High Shine Glossy Finish, Lightweight Moisture Enriched With Agave, Moringa Oil Capuacu Butter – Pink Obsessed
- REVLON Colorstay Satin INK, Comfortable, Longwear Rich 16-Hour Liquid lip Color, Formulated with Black Currant Seed Oil & Vitamin E, Fire & Ice – (015)
- H&M Upto 72% OFF + Extra 20% OFF + 15% OFF Coupon | Stack Coupons & Save Big
- Bevzilla Pack of 2 English Butterscotch Coffee Powder Instant Coffee (2 x 75 g, Butterscotch Flavoured)
- Boat Airdopes 141 Gen 2, 4 Mics ENx Tech, 48 Hrs Playback, Free Music Streaming, Fast Charge, Low Latency, IPX4, v5.4 Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Orange)
- Gillette Mach 3, Shaving Razor For Men | Most Comfortable Shave | 3D Blade Technology | Metal Handle For Superior Grip
- Gillette Fusion 5, Shaving Razor For Men | With Beard Shaping Back Blade | 5 Blades For Your Perfect Shave | Styling Back Blade For Your Perfect Beard Shape
- Cello Aluminum Hard-Anodised Classy Kadhai, 2.5 LTR with Steel Lid, Gas Stove Compatible only, Black
- Motorbike Helmets
- Milton Eiffel 1000 Vacuum Insulated Thermos Flask with Strap to Carry, 910 ml, Long Hours Hot & Cold Water Bottle for Office, Hiking, Trekking, Travel, Black
- Whisper Super Absorbent Period Panty, 12 L-XL Pants, 360 Degree Leakage Protection* for Heavy Flow, Panty like Fit, Full back Coverage, Absorbs Heavy Gushes, Silky Soft, Comfortable Feel
- Larah by Borosil Boro Fluted Series Opalware Dinner Set | 33 Pieces for Family of 6 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- La Opala Opal Glass Crockery | for Family of 6 | Dinner Set 35 pcs Pink Florets | Plates & Bowls for Dining | Microwave Safe | 100% Vegetarian | Extra Strong | Extra Light & White
- Woohome Green Shade Net(10 X 15Ft) UV Stabilized Agro Net for Terrace, Balcony, Garden & Greenhouse | 75% Sun Protection | Heavy-Duty Net for Plants, Outdoor & Farming Use
- Cello Opalware Aqua Leaves Dinner Set, 13- Units, White
- Saramonic SR-VM1S Cardioid Unidirectional Condenser Microphone for DSLR Cameras, Camcorders
- Clovia Women’s Cotton Cactus Print Top & Chic Basic Joggers Pajama Set
- Larah by BOROSIL Fluted Series Lavender Opalware Dinner Set | 27 Piece for Family of 6 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- Safari Medium Polycarbonate Spinner Thorium Neo 8 Wheels 66Cm Size Check-in Trolley Bag, Hard Case, 360º Wheeling Luggage for Men & Women, Travel Bag, Suitcase for Travel, Dusk Green
- Beardo Whisky Smoke Solid Perfume Wax for Men | Long Lasting Fragrance | Date Night Scent | Travel-Friendly Solid Perfume | 10g
- boAt Type C to C 65W Fast Charging Cable with 480 Mbps Data Transfer, Tangle-Free Cable in Premium Nylon Braided Design (Arctic White)
- Marks & Spencer Baby-Girls Track Pants
- Boat Airdopes 219, 4Mics ENx, 40H Battery, Best in Segment for Calling, Stream Ad Free Music via App Support, Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Forest Sage)
- SignoraWare BPA Free Plastic Square Dinner Set | Microwave Safe | Unbreakable & Lightweight | Odor-Free | Great for Parties & Gatherings | Ideal for Regular Home Meals (Set of 24 pcs | White)
- Pure Source India Metal Stand and Brass Bowl Camphor Burner/Aroma Lamp/Dhoop Burner/Aroma Burner Square (4.75Inch) (Gold and Gliter Finsh)
- Pure Source India Oil Diffuser Set with Metal Powder Coated Stand and Pure Brass Bowl with 1 Tea Light and 10 ML Lemon Grass Aroma .(Oil Diffuser Set)
- Saramonic SR-MV58 Dynamic Handheld Mic for Live & Studio Recording Windscreen, Clip & XLR to 1/4″ Mic Cable, Mic for Live Performance Studio Recording
- Converse Day One Court Low Top Synthetic Sneakers For Men (Black , 10)
- Attro Hydrate 1000 Stainless Steel 900ml Water Bottle Sleek & Stylish Matt Finish Bottle Food Grade, Leakproof Perfect for Office, School & Outdoor- Dark Grey
- REVLON Ultra HD Snap Nail Polish, Glossy Nail Color, 100% Vegan Formula, No Base and Top Coat Needed, 014 Red and Real, 0.27 Fl Oz
- ATTRO Jupiter Lunch Box with 3 Inner Steel Compartment, 1 Small Container, 1 Spoon & Chopstick Air-Tight Leakproof Heat Water Insulation Design- 700ml+70ml Blue
- ATTRO Greek Yogurt & Curd Maker Fine Mesh Strainer with Lid Multifunctional Whey Separator for Homemade Yogurt, Curd, Cheese, Hung Curd & More – Easy to Use & Clean- White- 1100ml
- TAG WM500 White/Grey Wireless Mouse, 2.4GHz USB Receiver, Dedicated DPI Button (800/1200/1600), 4 Buttons, Ambidextrous & Light, Power-Saving, 10m Range, 1x AA Battery, Supports Windows/Mac/Linux/iOS
- ATTRO Treat Time Stainless Steel Insulated Lunch Box with Inner Steel Body, Airtight 4-Side Lock Lid, Leakproof Silicone Seal, Small Container-560ml+150ml-Football Champ Blue
- FOGG Fresh Fougere Perfume Scent with Long Lasting Eau de Parfum – 120 ml (For Men)
- Dabur Provides Damage Protection Non Sticky Formula For Hair Fall control & Shiny Hair Hair Oil (650 ml)
- Parachute Advansed Castor & Shea enriched Coconut Hair Oil 300ml | Up to 10x Stronger Hair| Moisturizes & Nourishes Hair | Reduces Hair Fall & Frizz | Prevents Hair Breakage| Vibrant Length & Volume| Dermatologically Tested | For Men & Women
- Floraware Plastic Refrigerator Storage Rack Set, Set of 3, Multicolour
- Dove Even Tone Radiance Serum Body Wash|5% Radiance Serum with Niacinamide| Gently exfoliates for even skin tone | Paraben & SLS free | 300 ml
- Milton Ernesto Inner Stainless Steel Jr. Casserole Set of 3 (390,720 and 1320 ml), Grey | Easy to Carry | Serving | Stackable
- Lenovo 100 Stereo Analogue Wired On Ear Headphones with Mic, Memory-Foam earcups, 30 mm Driver | Computer/PC or Laptop Headphone (Cloud Grey)
- Famous Quality Folding Materials and Smooth Surface Magnetic Chess Board for Kids and Adult, 10.2-Inch
- Nature Purify Mixed Dry Fruits Premium 1kg | Almonds, Cashews, Kishmish, Apricots & Seeds Mix | Fresh Crunchy Nut & Fruit Combo Pack for Snacking & Gifting | Jar Pack Of 1
- Floryzen Original Live Peace Lily or Spathiphyllum Plant Air purifier Good luck plant (Pack of 1 With Pot)
- Havells Inveno LX 1200 mm BLDC Ceiling Fan|ABS Aerodyanamic Blades|Telescopic Canopy|Timer, Breeze,Sleep,MOP Modes|Reverse Feature|100% Copper Wire Motor|Free Installation|2 Year Warranty(Matt Mist)
- HomeWiz 3-Layer Round Kitchen Trolley | Movable Storage Organizer for Fruits & Vegetables | Perforated Mesh Baskets with Solid Flat Top | Multipurpose Rack for Onion & Potato | Rust-Resistant | Black
- HomeWiz 2-Layer Round Kitchen Trolley | Movable Storage Organizer for Fruits & Vegetables | Perforated Mesh Baskets with Solid Flat Top | Multipurpose Rack for Onion & Potato | Rust-Resistant | Black
- HomeWiz 4-Layer Round Kitchen Trolley | Movable Storage Organizer for Fruits & Vegetables | Perforated Mesh Baskets with Solid Flat Top | Multipurpose Rack for Onion & Potato | Rust-Resistant | Black
- ASTRIDE Ergofit Ergonomic Office Chair for Home | 3-Years Warranty | 2D Headrest, Adjustable Arms & Lumbar Support | Tilt Lock Mechanism [Heavy Duty Nylon Base, Neon Green-Black]
- ZEBRONICS Juke BAR 9510WS PRO Dolby 5.1 Soundbar, Dolby Audio, 600 Watts, Wireless (Dual Rear Satellites & 6.5″ Subwoofer), Triple Driver Soundbar, Bluetooth v5.1 | HDMI (ARC) | Optical | USB | AUX
- Minnie Mouse Theme 4-String Toy Guitar for Girls – Lightweight & Durable Educational Musical Instrument for Toddlers – Pink Disney Character Guitar| Birthday Gift for Kids Ages 3+, 43cm
- DANIEL KLEIN Trendy Women Analog Watch – For Women DK.1.12766-7
- Studds Trooper Dv D1 Isi and Dot Certified Gloss Finish Flip-Up Full Face Motorcycling Helmet for Men and Women with Inner Sun Visor(Grey N1 L)
- Studds EPS FEMM Super Open Face Helmet (Matt Black, XS)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 6th June 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 6th June 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 6th June 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato