Pages
- Best Laptops Deals September 2026
- Best Smart Watches September 2026
- Mobiles
- Amazon Deals & Offers for September 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 20th September 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- WILD STONE CODE Chrome Long Lasting No Gas Body Chrome Black Perfume Spray For Men, Pack Of 2(150Ml Each)
- FitBox Sports Blend Gully Ball (Pack of 6) Cricket Ball for Street Match Cricket Ball Tennis & Lawn Cricket, Yellow
- NIVEA Derma Skin Clear Face Toner with Salicylic Acid & Niacinamide, Cleansing & Hydrating Toner for Visible Clearer Skin in 7 Days, Controls Oiliness, Removes Impurities, Blemish-Prone Skin, 200 ml
- ZEBRONICS ROBUST Premium Gaming Chassis with support for mATX | Mini ITX, Wraparound Tempered Glass, 120mm Multicolor LED Ring Fans, Top Magnetic Dust Filter, 3 Fans Included (White)
- Parachute Advansed Amla Hair Oil with Vitamin E | 500ml | Amla & Vitamin E | For All Hair Types
- Min 50% Off on Bata Sandals
- Kohler Multipurpose Towel Rack | Corrosion Resistant, Anti-Peel and Scratch Resistant | 304 Stainless Steel with Brushed Steel Finish | 2 Years Warranty (650L x 203W x 113H mm)
- Safari Medium Ray Neo 8 Wheels 65cm size Check-in Trolley Bag, Hard Case Polycarbonate 360 Degree Wheeling Luggage for Men & Women, Travel Bag Suitcase for Travel, Trolley Bags for Travel, Marina Blue
- Larah By Borosil – Tiara Series, Black Grey Cone, 10 Pcs, Opalware Floral Dinner Set, White
- Sony LinkBuds Open WF-L910 Bluetooth Earbuds with an Open-Ring Design for Ambient Sound, Mic, TWS, Upto 22 Hrs Battery, Adaptive Sound Control- White
- Nayasa Mikado Dustbin without Inner | 8.5 Ltr Litres Waste Bin | Plastic Dustbin for Home, Kitchen, Bathroom & Office | Durable, Easy to Clean, Hygienic & Stylish | Brown
- Mamaearth Vitamin C Daily Glow Body Lotion For Skin Brightening with Vitamin C & Honey 400ml|Nourishes Dry Skin|48 H Moisturization| 100% Natural Butter | Non-Greasy Smooth Skin | For All Skin Types
- KAMILIANT by American Tourister Savvy|Cabin Trolley Bag Small Size (55 cms) for Travel| Hard Case Polypropylene (PP) Suitcase|360° 8-Wheel Spinner Luggage Trolley|Combination Lock|Sea Blue
- Gesto 5 Meter LED Strip Lights |300 Led RGB Strip Light with Adaptor,Multicolor LED Lights for Home Decoration, Bedroom,Diwali Decoration & False Ceiling| Music Sync Bluetooth App. and Remote Control
- LEGO NINJAGO Zane’s Battle Suit Mech Pretend Play Toy Set 71827 Building Blocks Toys for 6+ Gift for Boys and Girls
- FREEMANS NEXA 5m 19mm + NEXA 7.5m 25mm Measuring Tapes
- Aristocrat Atlas Set of 3 (Cabin+Medium+Large) Hard Case Trolley Bags, White
- Fire-Boltt Ring X Smart Watch with 2.01” Always-On Display, Bluetooth Calling, Wireless Charging, AI Voice Assistant, 500+ Watch Faces, Health Suite, Smart Watch for Man & Woman – Black S
- RR Signature Vento Fresh Luxura 150 mm Exhaust Fan For Kitchen, Bathroom | Silent, Compact Design, Easy Install | Thermal Fuse | High Speed 100% Powerful Copper Motor | 2 Year Warranty [Wood Finish]
- ASUS MW105 Multi-Device Wireless Bluetooth Silent Mouse, Adjustable DPI, Ambidextrous Shape, Connects Upto 3 Devices, Optical Tracking, Compatible with PC/Laptop- (Black) 48 Grams, 3 Year Warranty
- GO DESi Jaggery Kaju Katli – 100g | Made with 69% Cashews and Palm Jaggery | Gud Kaju Katli | Indian Sweets | Sweets Gift Pack
- amazon basics All In One Undated Planner | Diary & Organizer | For Office Going Men & Women | Goal Setting, Time & Project Management (White)
- Park Avenue Voyage Obsession Signature Collection, Liquid Eau De Parfum Men, 50Ml | Long Lasting Perfume for Men | Diwali Gift | Premium Luxury Fragrance Scent | Aromatic Blend of Amber & Musk
- Axe Best Perfume for Men | Midnight Oak Fragrance | Long Lasting 12Hr | Aromatic Herbal Gourmand Spearmint cedarwood fragrance| AXE Premium EDP 100ml | Midnight Oak
- Kadio Analog 24.5 cm X 24.5 cm Wall Clock (Maroon, with Glass, Standard)
- Lifelong Storage Organizer 6 Layers | Foldable Wardrobe & Almirah Organiser | Durable Nylon Mesh & Non-Woven Edges | Basket Organisers for Storing Clothes (LLCOG06, Grey)
- Bagrry’s Plant Based Almond Drink 1L | Unsweetened | Roasted Almonds | Lactose & Dairy Free Almond Drink | No Added Sugar | Perfect for Everyday Use | Barista Approved | No Added Preservatives
- MILTON Sipmate 450 Stainless Steel Sipper Water Bottle 415 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Blue (TOM & JERRY)
- CELLO Falooda Glass Set of 6 Pcs 300ml, Transparent | Freezer & Fridge Safe, Leadfree Dishwasher Safe Toughened Crystal Clear Glasses Set for Drinking Juice Milkshake Cocktail Mocktail Coldrinks Soda
- Levi’s Women Jeans
- PaperO Professional A5 Square Grid Notebook | 5MM Square Graph Design | A5 Size (21.0 x 14.5 cm) | Ideal for Architects & Designers | Kraft Cover | 100 Pages | (Grid Book)
- Doms Groove HB/2 Super Dark Graphite Pencil Box Pack | Innovative Groove For Perfect Grip | Free Eraser & Sharpner Inside | Pack of 10 pencil
- TE-A-ME Matcha Tea – 50g | Japanese Matcha Green Tea Powder | Sourced from Japan
- Vega Lark Victor ISI Certified Gloss Finish Lightweight Open Face Helmet for Men and Women with Long Clear Visor(Black Orange, Size:M)
- Clazkit Water Carry Bottled Water Pail Bucket Handle Water Upset Bottled Water Handle Pail Buckets Lifter (20L Bottle Lifter) Water Bottle Handle (1) Plastic, Multicolour
- Cello Opalware Dazzle Series Florid Vine Dinner Set | Microwave & Dishwasher Safe | Light-Weight & Thermal Resistant | Crockery Set for Dining & Gifting | Set of 37, White
- Sulfar Food Cover Umbrella Tent Mosquito Protection Mesh Screen Reusable and Collapsible Outdoor Picnic BBQ Food Covers Net for Flies Bugs & Mosquitoes (Multicolor)
- Ganesh Stainless Steel Polo Insulated Lunch Box Container with Airtight Lid for Office & School Use/Food Grade/Air Tight/Easy to Carry/Leak Proof (750ml +140ml) Violet
- Ritu Plastic Organizers Storage Box Set of 3 | Transparent Containers (1600ml + 1000ml + 300ml) with Airtight Lids for Vegetables, Fruits, Fish & Eggs | Stackable, Durable, BPA-Free for Kitchen
- Fridge Storage Box Multipurpose Container for Storage Space-Saving Refrigerator Side Door Organizer for Kitchen Fruits, Vegetables Storage Containers- Transparent, 1 Pc, 950 ML
- CELLO H2O Premium Edition Water Bottles Set of 3 Pcs For Daily Use 1000ml Each, Grey | Unbreakable BPA-Free Leakproof Refrigerator Safe Pet Water Bottle For School, Office, Kitchen & Travel
- Dabur Gulabari Shower Gel – 250 ml | 99% Pure Glycerine | Gentle Bodywash | Himalayan Rose Extract to nourish and revitalise the skin | 0% Parabens & Soap | No Silicones | With Oudh Fragrance
- Wild Stone Legend Long-Lasting Body Deodorant Spray for Men, 225ml
- wipro Wpro Garnet 22w color changing 3 in 1 batten (Tri-color, pack of 2)
- CLINIC PLUS Strength & Shine Shampoo, 355 ml, for Shiny and Healthy Hair, with Egg Protein, Strengthens Hair Strands, Suitable for all Hair Types
- Garnier Vitamin C Sheet Mask, Hydrating, Brightening & Anti-Dark Spots, 28g
- Solimo Cotton Canvas Boards for Painting (20.3×25.4 CM, 15.2×20.3 CM, 15.2×15.2 CM) Combo Pack of 9,White
- Cello Melmoware Joycee Mugs, 200ml, Hoot Design, Pack of 1
- Zebronics Rocket 200 Portable Wireless Speaker with 20W Bluetooth 5.1, FM, USB, AUX, Deep Bass,Media & TWS, Microphone Input, Karaoke,Dual 5.08cm Drives,Call Function(Black)
- PHILIPS 10 w LED Bulb|3 Colors in 1 LED Bulb|Scene Switch Bulb for Home & Decoration|Color: Tunable White, Pack of 2, b22d
- Polycab Wizzy Vibe 1200mm 5-Star BLDC Ceiling fan for Home with Remote| Energy Saving | High Air Delivery | 3+1 yr Warranty [Matt White]
- L’Oreal Paris L Oral Moisture Filling Shampoo, With Hyaluronic Acid, For Dry & Dehydrated Hair, Adds Shine Bounce, Hyaluron 72H, 650Ml. | 650Ml
- Aarika Womens Casual Wear Purple Colour Abstract Woolen Cardigan
- Amazon Great Indian Festival Sale on Oct 8th
- Sulfar Bike Cover for TVS Apache (RTR 160 2V) | Waterproof, Dustproof & UV Protected | All Weather Two Wheeler Cover (Army Green) New 2026 Variants
- HRX Parabola Cabin Size Haileys Black Polypropylene Hard Shell Suitcase – Premium Travel Trolley Bag with 8 Spinner Wheels, Number Lock & Water Resistant Body
- Sage Square Deltz Two Wheeler (ISI Marked) Helmet for Men, Women (Extra Large – XL, Silver Glossy)
- realme TechLife 100.3 cm (40 inch) QLED Full HD Smart Google TV 2026 Edition (40FHDGQRDDRQ)
- TCL S5K 126 cm (50 inch) QLED Full HD Smart Google TV with 100% Color Volume Plus , 28W Dolby Audio , Google Assitant , Chromecast built-in ,Metallic Bezel-less , Slim Design (50S5K)
- Microfiber Feather Duster with Extendable Long Pole (100 Inches),
- Samsung Galaxy S26 Ultra 5G (Black, 12GB RAM, 256GB Storage) with Built-in Privacy Display, AI Phone, Photo Assist, Creative Studio, 200MP Camera, 5000mAh Battery and Snapdragon 8 Elite Gen 5
- Aarika Girl’s Cotton Blend Skater Knee-Length Dress
- Aarika Girls Casual Dress Cotton Classic Knee-Length Dress
- Aarika Girls Casual Wear Blue Colour Zig Zag Print Cotton Blend Frock
- AMD Ryzen 3 3200G Desktop Processor
- tu casa Wooden Table Lamp | Premium Floral Satin Shade | Solid Wooden Base | Modern Home Décor | Ambient Bedside Lighting | Bedroom, Living Room, Study Table, Office & Festival Gifting
- Sulfar Bike Cover for Yamaha R15M (Track-Spec Sports) | Waterproof, Dustproof & UV Protected | All Weather Two Wheeler Cover (Army Green) New 2026 Variants
- STEELLOCK Stainless Steel Airtight Container with Lid | Leakproof, BPA-Free | Multipurpose Food Storage Containers/Tiffin/Dabba for Office, School & Kitchen | SL-1202-set of 3, 350ml each, Yellow
- DABUR Vatika Rosemary Hair Growth Oil With Hibiscus & Coconut Oil – 100Ml | Stimulates Hair Growth And Thickness | Reduces Hair Fall | Co-Created With Dermatologist | No Mineral Oil |Animal Test Free
- Puma Men Cricket HighRun Cricket Shoe
- Ant Esports Virtus100 Wired RGB Gaming Mouse, White
- Spartan 4 Pcs Precision Pick and Hook Set | O-Ring, Oil Seal, Gasket Puller & Remover Tool Kit for Car, Auto Repair, Mechanical, DIY & Workshop Use
- Giordano Luxury Watch for Men with Textured Dial, Crystal Bezel, Date Display and Stainless Steel Strap
- Amazon Basics Wireless Keyboard and Mouse Combo | 2.4GHz Wireless | Full-Size 104-Key Keyboard with ₹ Key | Low-Noise Typing | Compact Ergonomic Mouse | USB Receiver | Windows XP 7 8 10 11
- BSB HOME 280 GSM Micromink Blanket, Premium Soft Warm Cozy Winter Blanket, Plush Double Bed Blanket, Ultra Soft Comfortable Bedding, Embossed Floral Design, 40 x 80 Inches (103 x 205 cm) – Espresso
- ROKTRY 1 pcs Plastic Restorer for Cars ,Lasting Auto Restoring Liquid , Exterior and Interior Plastic Revitalizing , Resists Water,Auto Exterior & Interior Plastic Cleaner
- Faber-Castell Neon Origami Mini Kit
- Kuchipoo Girls Regular Fit Cotton T-Shirts and Pyjamas Clothing Set-Pack of 3
- Arto Bright Outdoor Security Lights with Motion Sensor Solar Powered Wireless Waterproof Night Spotlight for Outdoor/Garden Wall, Solar Lights for Home (100 LED) (Pack of 1)
- SIKA – SikaCeram 888 Tile Grout EP – Coloured tile grout and tile adhesive – Water cleanable and chemical resistant – Stainless and colourfast – Light ivory – 1kg
- Flipkart SmartBuy Falcon Neo with 12 Months Warranty 400 mm Pedestal Fan (Beige | Pack of 1)
- Amazon Basics Premium Imported Garden Theme Cat Tree | XL | with Cat Home, Jumping Platform, Scratching Posts and Tree Leaves
- Nayasa Tricep Plastic Water Bottle | BPA-Free Leakproof Sports Water Bottle for Office, School & Gym | Lightweight Daily Use Bottle | Green
- Zebronics Wireless Keyboard & Mouse Combo, 104 UV-Printed Keys, ₹ Key, 12 Multimedia Keys, Retractable Stand, 4 Button Mouse, 1600 DPI, High Precision, USB Nano Receiver (Companion 304, Grey)
- Symbol Men’s Cotton Formal Shirt | Plain | Full Sleeve – Regular Fit (Available in Plus Sizes)
- SNITCH Loop 2Pc Set Black Polypropylene Hard Travel Suitcase – Trolley Bag Set of 2 & Luggage with 4 Wheels, Secure Lock & Free Shoe Bag
- Ajmal Shiro Perfume for Men (14 ml)
- Motichoor Candle Set of 6 Handmade Soy Wax Laddu | Decorative Candles | Diwali, Wedding & Festive Giftings Home Décor | Sweet-Shaped Candle| Living Room, Entrance, Balcony & Pooja Décor
- Cricut Cold-Activated, Colour-Changing Vinyl – Permanent, Light Blue – Turquoise
- Aristocrat Oasis Plus Set of 3 Cabin, Medium & Large Size Soft Luggage (59 cm, 69 cm & 79 cm) | Spacious Polyester Trolley with 4 Spinner Wheels and Combination Lock | Dazzling Red | Unisex
- GRAPHENE Remote Control Airplane for Kids RC Fighter Jet Plane Toy LED Lights 360° Flip Stunt Roll Hovering Spinning Stable Flight Easy to Fly Foam Aircraft Glider Hobby Toy Boys Girls Adults
- Premium Plastic Bathroom Shelves – Pack of 2 Wall Mounted Storage Racks for Shower, Vanity & Toilet – Durable, Waterproof, Easy‑Install No‑Drill Design – Organizer for Toiletries, Towels
- Highlander Cotton Men Shirt, Regular Fit
- Zebronics 2026 Launch Portable Bluetooth Speaker, 5W RMS, Up to 10Hrs Playback, Passive Radiator, TWS, BT v5.4, USB & mSD, 9 RGB Modes, Splash Proof, Type-C Charging (Sonic POD 15)
- Kenneth Cole Reaction Blue Silicon Strap Sports Wear Drum Roller Watch for Men’s – KRWGQ9006903
- POPWINGS Women Casual Azure Blue Floral Print Hooded Pocket Sweatshirt | Printed Sweatshirts | Women Sweatshirts | Winter Wear Sweatshirts Sweatshirts | Trendy Sweatshirts
- Noise Newly Launched Buds Connect 3 Truly Wireless Earbuds with 40H of Playtime, Quad Mic with ENC, Low Latency, 10mm Driver, BT V5.4(Sage Green)
- Portronics Toofan Nano Rechargeable Handheld Mini Fan, 3000mAh Battery, 18000 RPM High-Speed Airflow, BLDC Motor, 5 Speed Modes, LED Display, Type-C Fast Charging, For Travel, Office, Makeup & Outdoor
- Kcofoil 9 Mtr Food Grade Aluminium Foil ISI Certified food wrapping Packing|Pack of 1 Aluminium Foil (9 m)
- Door Latch & Chain Lock – Main Door Safety, 360° Viewer (Black)
- Libas Printed Rayon Straight Fit Kurta for Women Suit
- iPhone 18 Pro (256 GB) – Silver
- Leather Multi‑Color Car Sun Visor Organizer with Document Holder – 8‑Pocket Storage for Cards, Mobile Phone, Pens, Sunglasses, Receipts & Travel Accessories – Standard Size, 500‑Item Capacity
- Kuchipoo Boys Regular Fit Cotton T-Shirts and Pyjamas Clothing Set-Pack of 3
- FLOITTUY Portable Neck Electric Pulse Massager
- Crompton Star Lord JBNXT Junction Box Downlighter | 5W | Round | Green | Pack of 1 | Junction Box | Cutout: 3 inch, 75 mm | For use in halls, bedroom, kitchens, office, stores
- 8 Hook Wall Mounted Kitchen Utensil Holder Rack | Heavy Duty Multipurpose Hanging Rail for Spoons, Spatulas, Ladles, Knives, Scissors, Towels & Accessories | Space Saving Metal Organizer
- Heavy Duty Folding Shelf Brackets – Metal Collapsible Wall-Mounted Bracket for Bench, Table & Shelf | Space-Saving DIY Hinge Brackets for Home & Workshop | 1 Pair (20 Cm)
- LuvLap Pant Style Baby Diapers, Large (L), 62 Count, For babies of Upto 9-14Kg with Aloe Vera Lotion for rash protection, with upto 12hr protection, Diapers
- PHILIPS Stellar Bright 16 Watt LED Bulb, Base B22,Cool Day Light, Pack of 3
- Tokyo Talkies Women’s Sleeveless V-Neck Solid Dresses | Stylish| Casual
- Wild Stone Perfume Gift Set for Men 30mlx2 | Hero & King Perfume for Men | Premium Perfume Gift Set for Men | Eau De Parfums | Luxury Gift for Him | Long-Lasting Fragrance
- 360 Press and Spin Fidget Spinner Ball
- Havells Cosmo Pro 3+1 Reel| Extension Board – 5 Mtr ISI Marked Cable|3 Pin & 2×2 Pins Universal Sockets with Master Switch| LED Indicator| 6A, 240 Volts| Ultra-Smooth Rotation
- boAt Swift Lynk Hub with Type-C PD 100W 2-Way Port, 4K HDMI Output, Durable Aluminium Alloy Build, USB 3,0 Supports 5GB Data sync, Type-C Expansion Hub, Universal Compatibility(Silver)
- Portronics Toad 103 Wired Optical Mouse with 2400 DPI, Plug & Play, Ambidextrous, Hi-Optical Tracking, 1.5M Cable Length, 30 Lakhs Click Life, Ergonomic Mouse for Comfortable All-Day Grip (Black)
- wipro 2w intergrated Spotlight Pink(Pack of 3)
- LONGWAY Zephyr 1200 mm BLDC Ceiling Fan with Remote Control | BEE 5 Star Rated Energy Efficient | Ultra High Speed 3 Blade Anti-Dust Decorative Ceiling Fan (Silver Blue, Pack of 2)
- WRAPSTORE 99m Food Grade Butter Paper Roll 1 Kg | Non-Stick Food Wrapping Paper Parchment Paper (99 m)
- SignoraWare Fine Meal Stainless Steel Lunch Box | Airtight & Leakproof Lid | Compact & Lightweight | Tiffin for Office, School & Travel Use (300ml x 3 | Set of 3 | Steel)
- Dakshya Industries Round PVC Waterproof Table Placemat Pack of 1 | Dining Table Mat | Spill Resistant Heat Resistant Decorative Placemat, Gold
- JENSONS Stainless Steel Katori Bowls, Set of 6
- Electric Camphor Burner for Home, Plug-in Kapoor Dani with Heating Bowl, Karpuram, Bakhoor, Oud, Aroma Oil and Dhoop Diffuser Machine for Puja Room, Bedroom and Office Coffee
- Plastic & Stainless Steel Apple Cutter (Red) – Colors May Vary
- Gear Giant Monster Backpack 15″/20L Small Water Resistant School Bag/Casual Backpack/Daypack/Kids Bag for Boys/Girls (Black-Yellow)
- Larah by Borosil Helena Opalware Dinner Set, 13 Pieces, White
- Stainless Steel Green Coriander & Curry Leaves Storage Box | Air Ventilated Steel Food Container | Fresh Dhaniya/Kothmir Dabba | Sprouts & Herbs Fridge Storage (600m)
- Odomos Universal Liquid Vaporiser 45ml X Pack Of 6 | Mosquito Repellent Single Refill | 100% Protection| Fits All Machines | Protects Dengue, Malaria & Chikungunya Mosquitoes |
- Dabur Babool Ayurvedic Toothpaste -700g (350g x 2) | For Strong Teeth & Healthy Gums | Helps in Cavity Protection, Fresh Breathe | All Round Protection
- 30 Pcs Sleep Strips Mouth Tape for Sleeping – Anti-Snoring Strips for Nose Breathing, Snore Reduction & Better Sleep | Hypoallergenic Adhesive Mouth Stickers for Kids & Adults
- Alaukik Colourful Rajasthani Hat Monk | Figurine showpiece Decoration for Home Indoor,Outdoor,Office Desk,Porch Yard,Art Decor Set of 4
- Car Back Seat Organizer with 8 Storage Pockets, Hanging Car Seat Storage Bag with Adjustable Straps, Mesh Compartments for Bottles and Essentials, Black Organizer for SUV, Hatchback and Sedan Travel
- Naturali Anti-Hairfall Shampoo with Rosemary, Korean Ginseng & Biotin | Proven 3x Lesser Breakage from 1st Use | Promotes Hair Growth | Sulphate & Paraben Free Everyday Shampoo For Women & Men | 100ml
- Royal Silky Tissue Paper Napkins | 420 Napkins | 70 Pulls X 6 Packs | Soft And Highly Absorbent Smooth Disposable Napkins | Hygienic White Napkins for Home, Office & Dining
- UNITED COLORS OF BENETTON Caspian 16L Polyester 2 Compartment Laptop Backpack For Unisex – Red
- Liznoriz Vegetable Steamer Basket, Stainless Steel, 6 to 10.5 Inch
- Halonix 6W Decorer Wall Light | 6 Rays | Water Proof IP65 | Up & Down Wall Lamps – Outdoor Wall Lights for Elevation,Garden & Patio Lights – (Warm White)-Pack of 1
- Bonkaso Spin Mop with Stainless Steel Wringer & Big Wheels | 360° Rotating Mop, Adjustable Handle | Easy Floor Cleaning Bucket Set with 2 Microfiber Refills – Beige & Black (46 x 26.5 x 23 cm)
- Premium White Floor Cleaner Disinfectant Phenyl Liquid Surface Cleaner for Hospitals, Homes, Offices & Commercial Use Removes Dirt, Stains & Germs – 5 L
- Rotating Whiskey Glass with Stainless Steel Bearing
- Varanga Women Yellow Abstract Printed Straight Kurta Paired With Sharara And Dupatta
- GameSir Newly Launches Astro Junior Premium, Wireless Bluetooth, Over-Ear Headphones, Foldable, and Built-in Mic,5 Hours of Music & Talk Time, Ideal for Kids & Adults Men & Women (Blue)
- Window Curtains 5 Feet Pack of 1, Damask, Blue & White
- Cureveda Liposomal Vitamin B12 1500 mcg Tablets, 90 Count
- Colgate Sensitive Everyday Protection Toothpaste (160 g, Pack of 2)
- Lavie Women’s Betula Tote Handbag | Ladies Purse Handbag | Bag for Women | Rakhi Gift for Sister
- Noise Buds Mini Truly Wireless Earbuds (2026) | Half in-Ear Design | 40H Playtime | Quad Mic ENC for Clear Calls | 13mm Driver | Low Latency Gaming Mode | BT v5.3 | IPX4 Sweat Resistant – Jet Black
- ZEBRONICS LPC77A Black Toner Cartridge – Without Chip, Compatible with HP Pro LaserJet M304, M404, MFP M329 and Enterprise MFP M431f Series
- GOQii Insure+ 5 lakhs Health Insurance with Smart Vital Stream (Black) and 3 Months Personal Coaching
- Mini Steps 7-in-1 Early Learning Flash Cards – 196 Educational Cards for Babies, Preschool & Toddlers (12+ Months)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who was the top scorer for India in the T20 World Cup final 2024?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 20th September 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 20th September 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 20th September 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbabydodiedobajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdecathlondistrictdmartDomino'sdroomeazydinerelementsepicgamesfastandupfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsyskyscannersnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato