Pages
- Best Laptops Deals April 2026
- Best Smart Watches April 2026
- Mobiles
- Amazon Deals & Offers for April 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 26th April 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Larah by Borosil Fluted Series Lavender Opalware Dinner Set | 13 Piece for Family of 4 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- Treo by Milton Orbit High Borosilicate Glass Tea & Coffee Mug Set of 1, 250 ml I Micro Wave & Refrigerator Safe I Reduced Condensation I Food Safe I Premium Gifts for Woman, Man
- Larah by Borosil – Tiara Series, Black Grey Cone, 13 Pcs, Opalware Dinner Set, White
- MILTON Curve 2500 Inner Stainless Steel Casserole, 2.15 litres, Maroon | BPA Free | Food Grade | Easy to Carry | Easy to Store | Chapati | Roti | Curd Maker
- Milton Olive Plastic Container with Lids, 245 ml, Clear Kitchen Storage Box Set of 3, Food Storage Jars for Kitchen, Tea Sugar Container, Airtight, Durable, Multi-purpose, Ideal for Kitchen Essentials
- Treo By Milton Vintage Glass Jar With Plastic Lid, 1200 ml, Transparent |Storage Jar | Kitchen Organiser | Modular |Food Safe | Transparent | Refrigerator Safe | Air Tight
- Milton Orchid 1000 Inner Stainless Steel Serving Casserole with Lid, PU Insulated Kitchen Hot Pot, Keeps Food hot & Fresh for Roti, Biryani, 790 ml, Blue
- Spotzero by Milton Stainless Steel Utensil Scourer Jumbo, Stainless-Steel Scrubber, Multipurpose use Utensils, Pots, Pans, Ovens, Sink, Tiles, Bathtubs, Machine
- Parachute Advansed Ultra Nourish Hair Serum | Coconut & Rosemary | 48 Hr Frizz Control | 10X Strong Hair | 100ml
- CELLO Inspire Large Sipper Water Bottle, 900ml Black | Food Grade, Leakproof, Easy to Carry | Gym Straw Water Bottle For Fitness, Office, School, Sports, Picnic, Travel & Outdoor Hydration
- Portronics Adapto 12 2.4A 12W Fast Wall Charger for iPhone 11/Xs/XS Max/XR/X/8/7/6/Plus, iPad Pro/Air 2/Mini 3/Mini 4, Samsung S4/S5, and More(White)
- Parachute Advansed Deep Nourish Body Lotion for Women & Men, Dry Skin, 225ml | Pure Coconut Milk, 100% Natural, 72h Moisturisation
- Dabur Gulabari Moisturizing Body Lotion – 800 ml (Pack of 400ml x 2) | For Men & Women | Dry Skin Care | With 100% Organic Rose Oil & Shea Butter | Dermatologically Tested | Paraben Free | 72 Hour Moisturisation
- DR. FIXIT 201 Crack X Paste-1Kg, Ready to Use Filler for Internal & External Surface Cracks on Roofs, Walls – Flexible Putty With Excellent Bonding – Pack of 12, Acrylic
- Pigeon Oven Toaster Grill 14 Liters OTG| 900 Watts| Toast, Grill, Bake & Roast | Heat Resistant Tempered Glass| Black
- Claret Oil Grease Proof Food Wrapping Paper | 9+2 Meter Roll | Eco-Friendly Non-Stick Butter Paper for Burgers Snacks Sandwiches (Pack of 2)
- Yardley London London Rose Underarm Deodorant Roll On | With Licorirce Extract & Floral Extracts | Smooth & Eventoned Underarms | 72 H Long Lasting Floral Scent| 0% Alcohol & Dermat Approved | For Women | 50ml
- Villain Snake Perfume for Man -100ml Long Lasting Smell | Premium Luxury Masculine Fragrance Gift For Men | Eau De Parfum for Party, Wedding Gift for Him | Ozonic, Patchouli, Amber, Musk EDC Notes
- Bombay Shaving Company Tokyo Perfume for Men | Fresh and Soothing Long Lasting Fragrance | Eau de Parfum | Gift for Men | Gift for Husband | Gift for Boyfriend | 100ml
- Himalaya Herbals Babycare Gift Jar (Soap, Shampoo , Rash Cream and Powder), White, 4 Count (Pack of 1)
- GNC Pro Performance Pure Micronized Creatine Monohydrate | 50 g| Pack of 3 | Assorted | Instantized | Fuels Muscles | Increase Muscle Mass | Rapid Absorption | Boosts Athletic Performance
- 30 Cashback on Fastag Recharge of Min 10 Bajaj Finserv (9am – 12pm)
- BEARDO Don’s Beard Growth Pro Kit | Complete Beard Growth & Grooming Kit for Men | Ideal Gift for Men | Beard Care Starter Kit | Gift for Husband
- LG 655 L Frost Free Smart Inverter Double Door Side by Side Refrigerator (GL-B257HWBY, Western Black, Express Freezing | Multi Air-Flow)
- Kobo Self-Locking Weight Lifting Belt – Premium Weightlifting Belt
- Duke Stardust Women Full Sleeve Jacket
- Duke Mens Casual Jacket
- Johnson’s Johnson Buds Gentle, 150 Swabs (White, 75 Count)
- Everyuth Naturals Purifying Neem Face Wash|Antibacterial Neem & Tea Tree Oil|Hydrated, Clear & Healthy Skin|Paraben free|100% Soap Free|Oily, Dry, Normal, Combination & Sensitive Skin -150 g
- Beardo Midnight Legacy Combo for Men- LSD & GodFather Perfume for Men (20ml x 2) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Mamaearth Neem Moisturizing Lotion Soap with Neem & Tea Tree for Skin Purification (3 + 1 Free) – (125 gm x 4) | Units For Skin Protection | Soothes Inflammation | Deeply Cleanses | 76% TFM Grade 1 Soap
- Mother Sparsh 99% Pure Water (Unscented) Baby Wipes with Lid I Natural Plant made cloth – Super thick Wet Wipes I 72 pcs/pack – Pack of 2 (Super Saver Pack)
- Loafers with Metal Accent, Low-Top by LEE Cooper
- Mamaearth Ultra Light Indian Sunscreen with Carrot Seed & Turmeric | SPF 50 PA ++++ | UVA & UVB Protection | Tan Protection | No White Cast | Non-Greasy & Quick Absorbing | Super Lightweight | Suits All Skin Types | In-Vivo Tested | 80 g
- Mamaearth Multani Mitti Moisturizing Lotion Soap with Multani Mitti & Rose for Oil Control & Acne (3 + 1 Free) (125 gm x 4) | Benefits of Lotion | Deeply Cleanses & Moisturizes | Grade 1 Acne soap
- Whirlpool 184 L 2 Star Direct-Cool Single Door Refrigerator (205 WDE CLS 2S SAPPHIRE BLUE-Y, Blue, 2026 Model)
- Bosch 303L, 3 Star, MaxFlex Convert Frost Free Triple Door Refrigerator | 8-in-1 Convertible Storage Modes | 57L Extra Convertible Zone | Cool Extend up to 18 hours (CMC33S03NI, Shiny Silver)
- Samsung Galaxy Buds3 Pro Wireless Earbuds, Powered by Galaxy AI, IP57, Active Noise Cancellation, Adaptive Noise Control, 37hrs Battery, 360 Surround Sound, Pinch Controls, Galaxy Ecosystem, Silver
- Puma Womens Carina Mia Mid Sneaker
- SINGER Electric Airfrio Air Fryer 1350W | 4.4L Basket | 100% Oil-Free Cooking | Digital Display | 10-in-1 Functions | 360° High-Speed Air Circulation | ISI Certified | 2 Years Warranty
- Acer Nitro V AMD Ryzen 5 Hexa Core 7535HS – (16 GB/512 GB SSD/Win…more
- Milton Go kettle & Flip Lid 12 SKU Dummy (K1500+FLIP500)
- Bata Boys Riley Blue Casual Shoes, (4399088)
- Furniture Café Engineered Wood TV Cabinet for Living Room, Set Top Box Stand & Wall Display Rack | Dining Room, Bedroom (Upto 32″ Inch) (Brown-White)
- Intex 4 Feet Swimming Pool for Kids Non-Air Without Air Home Garden Farmhouse, No Need for an Air Pump Just Unfold and Ready to Use
- Kenstar Estella 1.6L Electric Kettle | Stainless Steel Body | Auto Cut-Off & Dry Boil Protection | 360° Swivel Base | 1350 W | SS Finish
- Asian Paints Trucare Heat Gun 1800 Watt Quick Hot Air Blower with Dual Temperature Setting & Nozzle Attachment for Indoor and Outdoor Shrink Wrapping Packing Drying Paint Coats (Pack of 1, Yellow)
- LIMESTONE Analog Watch – For Men LS3314_Fk
- Ketch Women’s Fit and Flare Full Length Dress
- CareFoam Height Adjustable Microfiber Sleeping Pillows – Set of 8 | 16″ x 24″| Soft, Supportive & Washable | Ideal for Back, Side & Stomach Sleepers | White & Grey Cover
- Havells Glydo 1000 watt Dry Iron With American Heritage Non Stick Sole Plate, Aerodynamic Design, Easy Grip Temperature Knob & 2 years Warranty. (Charcoal Blue)
- Zureni Rectangular Bucket Spin Mop with 2 Wet/Dry MopHead Extendable Handle Removable Plastic Wringer 360° Floor Cleaning Mopping Set (Random Colour)
- RR Signature Morpheus1200MM Star-rated BEE Certified Energy Efficient 52-Watt High Speed Ceiling Fan (Brown) (Pack of 3)
- LookMark Casual Shirt for Men Shirt for Men
- PANCA Gas Toaster Grill Sandwich Maker | Cast Aluminium Non-Stick Coated Sandwich Griller with Long Handle | Portable Gas Sandwich Maker (Grill Toaster)
- WildHorn 31L Laptop Backpack for Men/Women I Fits upto 15.6″ Laptop I Waterproof I Travel/Business/College Bookbags
- Lifelong Nose Trimmer for Man | Nose Hair Trimmer for Women | Rechargeable Painless Nasal Hair Cutter, Ear Hair Remover, Eyebrow Scissors | Unisex Nose and Ear Hair Trimmer |Electric Hair Removal Pen
- Yardley London Gentleman Classic With Woody Fougere Notes Body Deodorant Spray – For Men (660 ml, Pack of 3)
- Dabur Cold Pressed Groundnut Cooking Oil – 1L | Rich in antioxidants | Good for Heart health | Enriched with MUFA & OMEGA 6 PUFA | Aroma of Purity
- Cetaphil Gentle Exfoliating SA Cleanser 29ml | Daily Foaming Face Wash with Salicylic Acid, Mandelic Acid & Gluconolactone | Smooth, Even Skin | For Sensitive & Acne-Prone Skin
- CELLO Executive Glass Beer Mug with Handle Set of 2 Pcs, 400 ml Transparent | Freezer & Fridge Safe, Durable Leadfree Dishwasher Safe Toughened Glass Mug for Serve Beer, Cocktail Mocktail & Beverages
- CELLO Unity Whiskey Rocks Glass Set of 6 Pcs, 215 ml Transparent | Leadfree Freezer & Dishwasher Safe, Toughened Glass Set for Bar, Liquor, Whiskey, Cocktail, Mocktail, Mojito & Cold Beverages
- CELLO Secret Garden Dazzle Series Opalware Dinner Set of 35 Pieces for Family of 6 | Bone-Ash Free & Leadfree Opal Glass, Microwave & Dishwasher Safe, Plates & Bowls Crockery Set for Dining & Gifting
- Cello Dazzle Series Blue Swirl Opalware Dinner Set | 28Pcs | White | Microwave & Dishwasher Safe | Light-Weight & Durable | Chip & Scratch Resistant | Best for Special Occasion & Gifting Purpose
- Bajaj DMH 85X 85L Desert Air Cooler | High Air Delivery with Turbo Fan Technology | 3-Side Honeycomb Cooling & 4-Way Swing | Inverter Compatible | 1 Year Warranty
- Hisense 164 cm (65 inches) E6N Series 4K Ultra HD Smart LED Google TV 65E6N (Black)
- CELLO Zenith Round Serving Glass Bowl for Kitchen 1 Litre, Transparent | Microwave Oven & Dishwasher Safe, Freezer & Fridge Safe, Leadfree Toughened Crystal Glass Bowl for Serving Mixing Dining
- Cult Active body Weighing scale, LCD display, Weight Machine, 180 Kg, Batteries included, Tempered Glass Platform, Ideal for Home Use, Grey.
- Fastrack Chrome K Quartz Analog with Maroon Dial Titanium Brass Solid Strap Watch for Women – 6216QM03
- Asian Paints TruCare 26-in-1 Pcs Hex/Allen Key Set | Carbon Steel with Rust & Corrosion Resistant | Chrome Plating & Satin Finish | Multipurpose Tool Kit with 25° Ball-End Angle
- Amazon Basics Polyester XXL Pet Bed with Cushion | Ideal for Big Dogs | Washable | Suitable for Multiple Pets |110 x 93 x 20 cm
- Engage Nature Deo: 2 Woody Musk & 1 Forest Fresh (150ml X 3) Deodorant Spray – For Men (450 ml, Pack of 3)
- Engage Deo Combo 2 Intrigue for Her 150ml & 1 Spirit for Her 150ml Deodorant Spray – For Women (450 ml, Pack of 3)
- Lifelong Adjustable Hand Grip Strengthener, Polypropylene Hand Gripper for Men & Women for Gym Workout Hand Exercise Equipment to Use in Home for Forearm Exercise (5-60kgs) – Blue & Black, LLFAHG001
- CELLO Scarlet Bliss Dazzle Series Opalware Dinner Set of 37 Pieces for Family of 6 | Bone-Ash Free & Leadfree Opal Glass, Microwave & Dishwasher Safe, Plates & Bowls Crockery Set for Dining & Gifting
- CELLO Oxford Imperial Plus Series Opalware Dinner Set of 19 Piece For Family of 6 | Bone-Ash Free & Leadfree Opal Glass Microwave & Dishwasher Safe, Crockery Plates & Bowls Set For Daily Use & Gifting
- GreenFinity Premium Seedless Fresh Green Raisins 500g Value Pack – Nutritious, Sweet, and Healthy Snacking Option with Seedless Green Kishmish
- Tata Power EZ Home Wifi MOSFET Smart Switch 16A 1 Channel, Modular Home Automation Product, 2_Way, Track Power Usage, White
- Lifelong Heart Shaped Hot Water Bottle 1000 ml with Washable Fur Cover | Hot Water Bag for Pain Relief & Period Cramps | Ideal for Hand & Belly Warmer | Comfort with Leak-Proof Design (LLEHWB18)
- Lifelong Gym Shaker Bottle – BPA Free Protein Shaker for Men & Women with Extra Compartment | 600ML | Leakproof Shaker for Supplements & Powders – Red
- CELLO Estella Nexus Color Silver Mist Plain Mug Set of 6, 90ml, Grey | Scratch Resistant | Porcelain Tea, Coffee Mug Set | Ideal for Daily Use & Gifting | Dishwasher Safe | Small Mug |
- Patanjali Kesh Kanti Hair Cleanser Natural Shampoo, Herbal Care for Healthy Hair, Suitable for All Hair Types (650 Ml)
- HIMANSHI HERBALS Organic Fennel Seeds (Saunf) 500g – Natural, Fresh & Aromatic, Saunf for Cooking, Mouth Freshener & Wellness, Rich Flavor, Hygienically Packed
- Maharaja Whiteline Smart Mixer Grinder | 500-watt | 20000 RPM Motor Speed | Air Ventilation System | Stainless-Steel Jars & Blades | Unique Jar Flow Breakers | 2 Year Motor Warranty |Blue
- Havells Beard & Hair Trimmer |2-in-1 Special Blade| Comes with 4 Beard & 2 Hair Combs|Type C Turbo Charge|No Nicks & Cuts|2 Year Guarantee|BT4001
- Cureveda Liposomal Vitamin B12 1500 mcg Active Methylcobalamin Aloe Vera | High Absorption Tablets for Nerve Health, Memory & Energy | 90 Tablets (90 Day Pack)
- Larah by Borosil Fluted Series Erba Opalware Dinner Set | 6 Piece for Family of 2 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- Halonix 20W LED Cool White Batten, Pack Of 2, (Streak Squar), B22D
- HNY Digital Alarm Clock with Automatic Sensor, Date & Temperature Display, Compact LED Desk Table Clock for Students, Bedroom, Office, Living Room, Home Decor
- Midday Blade | Speed Racing Pull Back Cars | STEM Learning: Learn About Kinetic Energy | Educational Toy for Kids 7+
- Set Wet Ice Perfume for Men, 100ml|Citrusy Long Lasting Perfume for Men|Gift for Men|Best Everyday Fragrance
- Tedstree 4 Feet Teddy Bear/high quality/neck brow/cute and soft teddy bear – 120 cm (Pink)
- AGARO Dazzle Instant Teeth Whitening Kit with 14 Pcs Strips, Manual Dental Whitening Kit for adults, Oral Care, 24 Blue LED Light, Rechargeable, Removes Teeth Stains, Non Sensitive, Gentle & Safe
- Dettol Icy Cool Bathing Soap Bar With 3x intense cooling (750gm), 150gm – Pack of 5
- Parodontax Ultra Clean Toothpaste For Daily Protection Against Gum Problems, For Long Lasting Ultra Clean Feeling Multi Pack, 75g*2
- Dettol 5 in 1 Washing Machine Cleaner & Descaling Liquid for top load and front load| Lemon 250ml | Removes Limescale, Dirt and Bad odour | Kills 99.9%* Bacteria
- Purezento Modern Decorative Kieko Vases for Home Decor | Centerpieces | Kitchen | Office or Living Room for Home Decor Center Table, Flowers Pot, Bedroom Side Corners (White,6 Inch)
- ADD2CART Stainless Steel Serving Tongs, Kitchen Utility Chimta, Traditional Indian Flatbread Gripper (Utility Tong)
- The Better Home 1000ml Insulated Water Bottle | Doubled Wall 304 Stainless Steel | Stays Hot for Upto 18 Hrs & Cold for 24 Hrs | Leakproof | Insulated Water Bottles for Office, Travel | Black
- IGREJA Bright Like New Front/Top Load cleaning expert Blue Detergent Powder pouch 10kg Detergent Powder (Fresh) (10 kg)
- Kuchipoo Girls Regular Fit Cotton T-Shirts and Pyjamas Clothing Set-Pack of 3
- Kuchipoo Baby Boys and Baby Girls Pyjama Set
- Kuchipoo Boys Half Sleeves Cotton T-Shirt
- Kuchipoo © Marvel Boys Regular Fit Cotton T-Shirts and Shorts Set
- Kuchipoo Boys Regular Fit Cotton Shorts – Pack of 8
- Kuchipoo Girls Regular Fit Cotton Shorts – Pack of 8
- BELLAVITA NARCO Perfume & NIGHT FEVER Perfume combo|2X20ML|With Citrusy & Woody Notes| Eau de Parfum – 40 ml (For Men & Women)
- Plastic Flower Pots 6 Inch | Black Nursery Plant Pots for Indoor & Outdoor Gardening | Lightweight, Durable Pots with Drainage for Seeds, Succulents & Saplings | Pack of 10
- Multipurpose Gardening Scissors – Heavy Duty Garden Shears with Stainless Steel Blades and Soft Grip Handles for Pruning, Trimming, Harvesting, and Plant Care(GTK)
- SELLER ZONE Humidifier With Colorful Light For Room, Bedroom, Office, Car (Grey), 300 ML
- Ant Esports AEH0105 HDMI Cable 4K High-Speed HDMI Cord 18Gbps with Ethernet Support 4K 60Hz Compatible with Windows,Apple,UHD TV, Monitor, Computer,Xbox 360,PS5 PS4, Blu-ray, and More -1.5 Meter-Black
- XPR3SS Automatic Over/Under Voltage and Over Load Protection (Adjustable Setting) Energy Meter with Auto Re-Connect LED Display Standard Din-Rail Mounted Single Phase 220V, 63A (13.8kW)
- Paragon Men K1407G Men’s Stylish Lightweight & Durable Black & Red Velcro Dailywear Sandals Sandal (Black, Red , 8)
- Prayag PTMT T-Handle Bib Cock 15mm Wall Mount – White, Leakproof Rust-Free Tap Faucet Bib Tap Faucet (Wall Mount Installation Type)
- Olay 7in1 Ultra-light Face Serum | Niacinamide, Vitamin C, Collagen Peptides | Fights 7 Issues for Smooth & Glowing Skin | Normal to Oily Skin | Dermatologically Tested | Non Comedogenic | 30ml
- Caresmith Revive Scalp Massager | 96 Silicon Kneading Points with Detachable Heads | Scalp, Body & Head Massager for Hair Growth (Green)
- Nutriburst Multivitamin Gummies for Men and Women | Boosts Immunity, Energy & Overall Wellness | Vitamins A, B, C, D, E & Biotin | No Added Sugar | Health & Vitality | Mixed Berry Flavor | 100% Vegetarian | 60 Gummies
- Nutriburst Moringa 500mg – 60 Veg Tablets | Pure & Natural Moringa Supplement for Men and Women | Supports Immunity, Digestion, Energy and Active Lifestyle | Anti-Inflammatory Superfood
- Nextech 10000mAh MagSafe Wireless Power Bank, 15W Wireless Charging for iPhone 16/15/14/13/12, 22.5W Fast Charging, USB-C & USB-A Output, Compact Mini Power Bank for iPhone & Android
- Fastrack Men Perfume Travel Pack (3 x 20ml) – Compact Fragrance Set for Rakhi Gifting
- Cadlec 25-Litre Oven Toaster Grill (OTG) (MultiChef, Silver and Black)
- NIVEA MEN Active Clean Shower Gel,500 ml (Pack of 1)
- Dabur Almond Shampoo – 650 ml | For Nourished & Smooth Hair | Intense Nourishment | Helps in Hair Strenghtening | With Almond-Vita Complex & Milk Extracts
- Halonix Astron Star Base B22 12-Watt LED Bulb (Pack of 2, Cool White)
- Safari Trainer 48cm Duffle Bag with Shoe Compartment, Gym Bag for Men & Women, Sports Duffle, Travel Duffle, Training Bag, Olive Blitz
- Sounce 3 Meter High-Speed HDMI Cable – Hdmi Arc Enabled | 64 Gbps | 4K 120Hz | 1080P 240Hz | Strong & Durable | Supports Up To 32 Audio Channels | Gold Plated | 3Meter, Black (Pack of 1)
- Orient Electric Glint Room Heater for Home | Dual Heating Mode (1000/2000 Watts) | Overheat Protection | Dual Placement | 5 Level Safety Protection | Electric Fan Heater for Winter | Pack of 1 – White
- GM 3060 Extension Board 10Amp Output 250 Volts with 2 Mtr Extension Cord & Surge Protector | Master Switch, Safety Shutter, 4 International Sockets | Multi Plug Travel Adapter for Home Appliances
- Glam21 Ultimate Cover Foundation Stick | Face Foundation Stick with In-Built Brush | WaterProof, Long Lasting Formula & Natural Matte Finish | For All Skin Tone | 8gm| 01-Vanilla Twist
- Happilo Premium International Healthy Nutmix 350g | Almonds | Black Raisins| Cashewnuts | Cranberries | Green Raisins | Pistachio Kernels | Walnut Kernels healthy snacking | Dry Fruit | Trail Mix | Mix Nuts | Mix Dry Fruit
- Nike Red EDT Liquid 50Ml For Men Compact, Travel-Friendly Fragrance For On-The-Go Freshness,Easy To Carry
- MAK 25W Charger for Samsung Galaxy F23 5G Type C Charger Adapter Compatible with Galaxy F23 5G Charger, 25 Watt USB Type C to C Pd Charging Adapter C Type, White
- The Derma Co 10% Vitamin C Face Serum with 5% Niacinamide, Powered by Deep Penetration Formula™ | Fades Dark Spots | Reduces Pigmentation | Boosts Collagen | Brightens Skin | All Skin Types | 10 ml
- Greenfinity White Anjeer 250g | Premium Dried Figs | Vacuum-Packed Jar | Natural, Pure & Adulteration-Free | Rich in Fiber, Calcium & Antioxidants (250g [Pack of 1])
- Paper Boat Absolute Health Dry Fruits Mix, Premium Trail Mix | Healthy Mixed Nuts with Dry Fruits | Almonds | Cashews | Cranberry | Pumpkin Seeds | Candied Amla, Reusable Jar (1000g)
- Kindly 1,00,000 Rupees Money Saving Piggy Bank | Wooden Piggy Bank with Easy Tracking Coin Bank (Brown)
- Samsung 45W C-Type Super-Fast Charger Adapter for Samsung Galaxy S25/S25 Plus/S25 Ultra/S24/23/22/21 (Ultra/Plus/FE) A56/Note 20/S10 5G/9/8/M16 (S/A/F/M Series) USB C PD 3.0 Charge Adapter
- Tri-Activ Anti Mosquito Bat | 6 Months Warranty | Rechargable Upto 500 Times | Mosquito Killer Racket | Insect Killer & Fly Swatter | Long Lasting Battery |ISO Certified | Pack of 1
- Fogg Black After Dark |No Gas| Long Lasting Perfume Deodorant Spray for Men & Women-120 ML
- Lifelong Body Warmer Combo (Pack of 3) | 1 Body Warmer +1 Pair Hand-Warmers +1 Pair Foot Warmers | Natural Heat | Travel, Camping & Winter Essential | Long-Lasting Warmth up to 8 Hours |
- Dabur Gulabari Shower Gel – 250 ml | 99% Pure Glycerine | Gentle Bodywash | Himalayan Rose Extract to nourish and revitalise the skin | 0% Parabens & Soap | No Silicones | With Oudh Fragrance
- soundcore K20i by Anker, Semi-in-Ear Earbuds, Bluetooth Wireless, 36H Playtime, Fast Charge, Clear Sound, Comfortable Fit, ENC 2-Mic Clear Calls, Custom EQ, IPX5, Bluetooth 5.3, App Control
- Pass Pass Sweet Magic Mix Spice-Based Mouth Freshener | Digestive, High in Fiber & Antioxidants | For Fresh Breath | Pack of 3-115g Each
- CR1616 Lithium Coin Battery – Pack of 5
- Fiama Gel Bar Celebration Pack, 125g Soap (Buy 4 Get 1 Free) & Fiama Gel Bathing Bar Fresh Celebration pack, with 3 unique gel bars, 125g soap (Pack of 3), Blue
- eCraftIndia Golden Metal Lord Ganesha Shadow Tea Light Candle Holder | Ganesh Chaturthi Diwali Decoration Items for Home Decor | Tea Light Candle Holder Gift for Diwali, Housewarming
- HALONIX STRIKE BUG ZAPPER Blue Electric Insect Killer Indoor, Outdoor (Bat)
- Swagr Men Solid Ankle Length (Pack of 5)
- HP H250 Wireless Earbuds Crème
- Lifelong Fruit Basket for Dining Table & Kitchen Storage| Mesh Open Storage Bin| Fruit & Vegetable Basket – Countertop Storage Organizer for Onion Potato – Basket for Storage, Square, White
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 26th April 2026
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 26th April 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 26th April 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato