Pages
- Best Laptops Deals May 2026
- Best Smart Watches May 2026
- Mobiles
- Amazon Deals & Offers for May 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 17th May 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- NIVEA Lip Balm, Fruity Peach Shine,4.8 g (Pack of 1)
- TIMEX Analog Watch for Men with Round Dial & Water Resistant Man’s Wrist Watches
- Treo by Milton Empress Juice Tumbler I Premium Material Glass I Crystal Clear I Classic Design I Set of 6, 140 ml Each, for Water, Cold Drink I Perfect for Home, Restaurants and Parties
- MILTON Olive 750 Airtight Food Grade Modular Plastic Container | BPA Free, Stackable & Transparent | Wide Mouth with See-Through Lid | Ideal for Cereals, Pulses, Spices, Set of 3, 750 ml each, Grey
- Bajaj Ivora High Wattage Led Lamp 30W | Cool Day Light | Energy Efficient | B22 Led Bulb for Home | (Pack of 1) | White | 1 Yr Warranty
- Havells Beard & Hair Trimmer |2-in-1 Special Blade| Comes with 4 Beard & 2 Hair Combs|Type C Turbo Charge|No Nicks & Cuts|2 Year Guarantee|BT4001
- Kuber Industries Polyvinyl Chloride Foldable Mixer Grinder Cover for Table Top – Open Bottom, Waterproof Kitchen Split – Brown
- MILTON Fashion 500 Pet water bottle, 430 ml|Tritan Plastic|Leak-Proof, BPA-Free, Sturdy Handle|Reusable Water bottle for fridge|Perfect for Office, Travel, Gym Tumbler Bottle for Men and Women, Black
- Treo by Milton Orbit High Borosilicate Glass Tea & Coffee Mug Set of 1, 250 ml I Micro Wave & Refrigerator Safe I Reduced Condensation I Food Safe I Premium Gifts for Woman, Man
- Whirlpool 270 L (Gross Capacity 300L) Frost Free Triple-Door Refrigerator (FP 313D PROTTON ROY ALPHA STEEL (Z)
- Lakme 9-5 Eyeconic Kajal, Classic Brown, Smudgeproof and Waterproof that lasts upto 24H, for 2x dark pigment, 0.35g
- Japanese Formula Soothing Massage Gel for Joint & Muscle Pain Relief – Arnica, Mugwort, Hyaluronic Acid – Back, Neck, Knee & Leg Massage Balm – 100% Herbal Fast Absorption Formula (PACK OF 1)
- Crasts Ice Cube Trays Airabc Silicone with Removable Lid, Easy-Release Flexible 14-Cube Trays, LFGB Certified and BPA Free, Stackable Covers for Cocktail, Freezer
- MILTON Costa 1000 Pet Water Bottle Set of 2, 1 Litre Each | Airtight & Leakproof Stainless Steel Lid | Unbreakable, BPA-Free, Reusable Plastic Fridge Bottles for Home, Office, School, Travel
- Lifelong 2 in1 Portable Electric Kettle & Bottle for Travel 400ml |Wide Voltage-for Homes(220v) & Indian Trains(110v)| Quick Boil |4 Temp |Digital Touch Ctrl |Cool Touch |Make Tea/Coffee Without Milk
- Mivi DuoPods Marathon Earbuds Wireless | Fast Charge | 70H Playtime | BT v5.3 | 13mm Drivers | Noise Cancellation | IPX4.0 TWS
- Jivo Groundnut Oil 1 Litre | Cold Pressed, Unrefined Peanut Oil for Cooking | Vitamin A & D Fortified, Chemical-Free Ground Nut Oil 1L
- Dettol Skincare Moisturizing Beauty Bathing Soap Bar with Argan Oil (400gm) | Softer Skin, 100gm, Pack of 4
- Havells Vesta Electric Kettle| Large 1.7L| 2000 Watts| 360° Cordless Control| Wide Mouth for Easy Use|Triple Safety Protection | Premium SS Body| 1Yr Door Step Warranty by Havells
- Vaseline Aloe Fresh Body Lotion,24 HR Long Lasting Moisturisation with Aloe Vera extract and Menthol, 600ml
- Bournvita Chocolate Nutrition Drink, 200 g Jar
- LONGWAY Gusto 6 Inch 150 mm Energy Efficient Exhaust Fan | High Speed Powerful Motor | Noiseless Operation & Easy to Clean | Suitable for Bathroom, Kitchen, Office | 2 Years Warranty (Black)
- ZEBRONICS Thunder (2026 Upgrade) Wireless Headphones, BT v6.0, True 60 hrs Playback, 40mm Drivers, ENC, Gaming Mode, Dual Pairing, AUX & microSD, Rapid Charging, Call Function (Teal Green)
- ZEBRONICS Zeb-Jaguar Wireless Mouse, 2.4GHz with USB Nano Receiver, High Precision Optical Tracking, 4 Buttons, Plug & Play, Ambidextrous, for PC/Mac/Laptop (Light Blue+Grey)
- Zebronics ZEB-COUNTY 3W Wireless Bluetooth Portable Speaker With Supporting Carry Handle, USB, SD Card, AUX, FM & Call Function. (Green)
- Brut Sport Style Deodorant Body Spray for Men, Masculine Long-Lasting Deo with Refreshing, Athletic Fragrance, Imported (200ml)
- Biotique Natural Makeup Starshimmer Glam Lipgloss, Daring Desire, 3ml
- BSB HOME® Printed Polar Fleece Single Bed All Season Blanket/Comforter/Dohar 250TC – Pack of 5 (58×88 Inch, Pink, Green, Rust and Red)
- Gritzo SuperMilk Height+ (7-12y Boys), 10g Protein Powder, Double…more
- The Earth Store Cup O’clock Cup Set of 6 for Tea-200ml Each Capacity | Clock Print | Microwave and Dishwasher Safe Ceramic Tea Cup Ideal for Home, Office, Parties, Birthday Gift Chai Cups
- Misamo Enterprise Kitchen Faucet Extender, Chrome Plated, 3-Mode Spray Head, Flexible Extension
- BEARDO Perfume For Men – LSD, 50Ml | Amber Spicy Scent | Concentrated Sprays – Long Lasting Fragrance | Eau De Parfum Gift For Men | Strong EDP For Men | Gift For Husband | Gift For Boyfriend
- AGARO CV1077 Car Vacuum Cleaner, Portable, Handheld,12V DC /110W, 4.5KPA Power Socket, 14.7ft Long Cord, Stainless Steel Filter, Black
- Dabur Amla Hair Oil – 1100ml (550ml x 2) | For Strong, Long and Thick hair | Nourishes Scalp | Controls Hair Fall, Strengthens Hair & Promotes Hair Growth
- HyperX Pulsefire Haste 2 Dual Wireless RGB Gaming Mouse, Up to 26K DPI, HyperX 26K Sensor, 61g Ultra Lightweight, 100 Hr Battery Life, 1K Hz Polling Rate, 24 Months Warranty – Black [6N0B0AA]
- Glamveda Glycolic & Salicylic Acid And Potato Anti Pigmentation Face Wash (200ml) | For Reduces Dark Spots & Blemishes Tanning | For Men & Women | All Skin Types
- Zebronics Wireless Mouse, 2.4GHz, 3200 DPI, 3 Buttons, Comfortable & Ergonomic, USB nano Receiver, On/Off Switch, Power-Saving Mode, Works on Most Surfaces, for Mac | Laptop | Computer (Freego, Green)
- Storite UPort 1 Pack 1.8 Meter Power Cable for PC 3 Pin PC Power Cable 18AWG IEC Mains Kettle Lead Replacement for Desktop/Monitor/Printer – Black
- JIALTO 5 PCS Steel Wall Hanger for Clothes, Door Hooks, Bathroom and Door Cloth Hanger, Mounted Hangers for Shirts, Dresses, and More (Silver, 1 Hook)
- Nippon Paint Quick Coat Interior Emulsion Paint – 10 KG (BLUE SCARF)-Quick Drying, Good Coverage, Low VOC-Paint for Wall, Living Room
- Hydrating Shampoo 300 ML for Dry, Frizzy & Dehydrated Hair, Anti-Dryness Shampoo, Hydrates and Moisturizes Bouncy Hair Full of Life Enriched with Aloe & Cruelty- Sulfate- Paraben Free
- Parachute Advansed Protein Shampoo | with Coconut Milk and Aloe Vera | For up to 100% Damage Repair & up to 3X Softer Hair | Protein Lock Technology | Paraben-Free | For Men & Women | 80ml
- Bajaj Almond Drops Nourishing Body Lotion With Almond Butter | 72 Hr Moisture Retention | Enhances Skin Glow | Improves Skin Barrier | For All Skin Types | 400 ML
- Signoraware Opulent Non Stick Tadkapan 13cm | Ergonomically Designed Handle | Compact, Efficient & Stylish Tadka Pan | Ideal for Quick Tasks tadka for dal & Seasoning for Veggies (500ml | Steel)
- Monte Carlo Polyester Comforter Double Bed | 200 GSM Lightweight & Reversible | Soft Quilt for Mild Winter | Easy Care All Season Comforter (Blue/Maroon) | 87 x 94 Inches
- Monte Carlo Polyester Comforter Single Bed | 200 GSM Lightweight & Reversible | Soft Quilt for Mild Winter | Easy Care All Season Comforter (Charcole) | 59 x 87 Inches
- AXE Signature Champion Long Lasting No Gas Body Perfume For Men 200 Ml, Spray
- Patanjali Kesh Kanti Hair Cleanser Milk Protien Shampoo, Herbal Care for Healthy Hair, Suitable for All Hair Types (650 Ml)
- Reynolds Metal Pens (Iconic Elite Gun Metal) | Premium Pens For Gifting | Twist Pens For Personal & Professional Use | Stylish Gifts for Men & Women | Trim Ball Pens For Corporate Gifting | Blue Ink
- Philips 4-watt Filament Candle LED Bulb | Diffused Candle Bulb for Home & Decoration | Bulb Base: E27, Warm White | Pack of 1
- POND’S Serum boost sunscreen For All skin types prevent and fade dark patches with the power of SPF 55 and NIACINAMIDE-C Serum 100g
- Bella Vita Luxury | Perfume Gift Set for Women 4x20ml | Gifts for Woman | Perfume for Woman | Date, Senorita, Glam, Rose Long Lasting EDP | Floral & Fruity Premium Fragrance
- Parachute Advansed Amla Rosemary Hair Oil | 500ml | Amla & Rosemary | For All Hair Types
- Livon Professional Smoothening Serum for Women & Men | With Vitamin E, Avocado & Almond Oil | For Smoother, Stronger & Frizz-Free Hair | No Paraben, Sulphate or Mineral Oil | All Hair Types | 100ml
- Axe Dark Temptation Men’s Deodorant + Axe Gold Temptation Long Lasting Deodorant Bodyspray For Men, With An Irresistible Scent 215ml, Pack of 2
- Vaseline Deep Moisture Body Lotion |For Dry Skin|Cushion Soft Skin| With Ceramides Hyaluron Moisture Fillers 600ml
- Story@HomeSingle Bed Comforter 180 GSM Reversible Microfiber | Comforter Single | AC Comforter Single Bed | Lightweight All Season Comforter | Blanket Single Size – Blue & Navy Blue
- POND’S Sun Miracle SPF 50 PA+++ Crème Gel Sunscreen-Protect & Bright, With 3% Niacinamide, Fade Dark Spots in 4 Weeks, Lightweight, No White Cast 100g
- Aktion AK H02_WHT Safety Helmets Rachet Type, Color: Green, Pack of 15, IS 2925:1984
- Upto 50% Off On U.S. Polo Assn. Men Briefs
- Pigeon Hydra Stainless Steel Drinking Water Bottle Flipper Cap, 0.7 Liters
- amazon basics USB-A to Type C Cable, Nylon Braided, Fast Data Sync, L Shape 60W PD Fast Charging Cord & Transmission Cable 1 Meter – Black
- Axe Dark Temptation Long Lasting Deodorant Bodyspray for Men 215 ml
- Park Avenue Euphoria, Eau De Parfum Men, 100ml | Long Lasting Perfume for Men | Premium Luxury Fragrance Scent | Aromatic Blend of Amber & Musk | Suitable for Every Occasion
- Casio Men Leather G-Shock Grey Dial Digital Dw-5600Pt-5Dr (G1334), Band Color-Brown
- Santoor Moisturizing Shower Gel With Natural Sandalwood & Gardenia Extracts| For Men & Women| Moisturizing Body Wash With Glycerin | Suitable For All Skin Types| No Parabens| No Silicones| 500ml
- Sony INZONE H3, MDR-G300 Wired Gaming Headset, Over-Ear Headphones with 360 Spatial Sound, USB Wired Over-Ear Professional + USB Connector, flip to Mute mic, App Support & PC Compatible (Black)
- Reynolds AEROSLIM Ball Pen SET – 25 BLUE PENS WITH COMFORTABLE GRIP |BLUE BALL PENS FOR WRITING | PEN FOR STUDENTS & OFFICE STATIONERY | 0.7 mm TIP SIZE
- Nayasa Plastic Square Ring Funk Mug, 1.5 Liter | Mug for Bathroom | Unbreakable Material | Green
- ZEBRONICS 10000 mAh 22.5 W Wireless With MagSafe Pocket Size Power Bank (Grey, Lithium Polymer, Fast Charging for Mobile)
- Eastman Y-Handle Socket Wrenches Set Of 1 Pcs, 10X12X14 Mm, Chrome Vanadium Steel & Knurled Sockets Satin Finish Selected Allow Steel Handle Tools (E-2220)
- Good Knight Flash Liquid Vaporiser Combo Pack | Machine + Pack Of 3 Refills | 2x Faster Than Before | Mosquito Repellent Refill | India s Most Powerful Liquid Vaporizer
- Kuber Industries 4 Layer Heavy Duty Plastic Storage Drawer with Wheels | Modular Cabinet for Bedroom, Office, Home | Chest of Drawers Organiser for Cosmetics, Kitchen items, Toys | Grey & Black
- Haier 215L Direct Cool Single Door 5 Star with Inverter Compressor, Base Drawer, Ice Formation possible in 60 Minutes, Fresh Veg & Fruit Box, Easy Clean back (HED-225PXBA-N, Purple Xsenia, 2026 Model)
- Mother’s Horlicks – Health & Nutrition drink (Vanilla flavor powder)Pack of 200gm Refill pack – No Added Sugar
- Havells DHMGCTPF006 PVC Plastic 6A MCB TP C Curve (White)
- Havells USB Star – 3+1 Extension Board| 1.5Mtr Copper ISI Certified Wire | Surge and Spike Protection | 3 Universal Sockets and 3 USB Ports, 3.1 Amp| 6A, 240 V AC | LED Indicator | Home & Office Use
- Fiama Gel Bar Celebration Pack with 5 unique Gel Bars, 125g (Buy 4 get 1 Free)
- Callas L Shaped Computer Desk – Gaming Corner 50 Inch PC, Computer Corner Desk, Writing Workstation with Wooden Desktop CPU Stand for Home, Office, Room & Small Space (White – ST-22 White(R))
- Giordano Designer Analog Women’s Watch Metal Strap Diamond Studded Classic-A2085
- Apple 5 W SMPS Charger for Smartwatch with Detachable Cable (White)
- KHODIYAR FASHION Unstitched Cotton Blend Shirt & Trouser Fabric Geometric Print
- Fiama Shower Gel Patchouli & Macadamia And Blackcurrant & Bearberry Body Wash With Skin Conditioners, 250 Ml Bottle (Pack Of 2)
- Fiama Body Wash Shower Gel Blackcurrant & Bearberry 250ml | Fiama Body Wash Shower Gel Peach & Avocado 250ml | Fiama Body Wash Shower Gel Lemongrass & Jojoba 250ml, Body Wash for Women and Men, Combo Pack of 3 for Moisturized Skin
- POND’S Dreamflower Floral Perfumed Powder with Glow-boosting Vitamin B3 For Women| Crafted with Superfine Minerals For Smooth Texture| Refreshing Long-Lasting Fragrance of Pink Lily| 200g
- Park Avenue Premium Men’s Soaps for Bath – Good Morning | 125g (Pack of 4) | Enriched with Tea Tree Oil & Shea Butter | Grade 1 Soap | For All Skin Types
- Cultsport Cult.Sport Burn Plus 1.78″ Amoled, Live Cricket Score, 368X448 Best-in-Class Resolution, Bt Calling, Crown Control, Always On Display, 7 Days Battery Life,(Blue Silicone Strap)
- by Bright, HDMI to Vga, HDMI to VGA Adapter (Male to Female) for Computer, Desktop, Laptop, PC, Monitor, Projector, Full HDTV, Media Players, Xbox [NOT for VGA to HDMI]
- Lymio Jackets || Jacket for men || Lightweight Outwear Jacket (J-04-06)
- Sounce Pack of 3 Belts/Straps Compatible with Fitbit Charge 5 Wristband Straps (3 Units), Water Resistant Dust Proof Professional Fitting [Watch NOT Included] (Grey, Black, Navy Blue)
- Fiama Body Wash Shower Gel Peach & Avocado, 750ml Family Pack, Body Wash for Women and Men with Skin Conditioners for Soft & Moisturised Skin, Suitable for All Skin Types
- Cello Eliza Laundry Basket with Lid (50 L) | Lightweight, Portable Plastic Storage Organizer for Clothes, Toys, Books | Multipurpose Hamper Bin | Light Grey
- CELLO Glassy Square Lunch Box with Jacket for Office, Transparent | 3 x 320ml Containers & 1 x 500ml Glass Bottle, Microwave Safe Leadfree Toughened Glass, Airtight Leakproof Tiffin Box for Daily Use
- CELLO Executive Glass Beer Mug with Handle Set of 2 Pcs, 400 ml Transparent | Freezer & Fridge Safe, Durable Leadfree Dishwasher Safe Toughened Glass Mug for Serve Beer, Cocktail Mocktail & Beverages
- Engage Femme Eau De Parfum for Women 50ml | Citrus Floral|Long Lasting Perfume |Everyday Luxury | Perfume for Women |No Paraben, Sillicones| Dermat-Tested EDP| Gift for woman|Also Try Maracuja Wine
- CELLO Classix Hi-Ball Glass Set of 6 Pcs 275 ml, Transparent | Freezer & Fridge Safe, Leadfree Dishwasher Safe Toughened Crystal Clear Glasses Set for Drinking Water Juice Milk Cocktail Mocktail Soda
- CELLO Glaze Glass Set of 6 Pcs 180ml, Transparent | Freezer & Fridge Safe, Leadfree Dishwasher Safe Toughened Crystal Clear Glasses Set For Drinking Water Juice Milk Cocktail Mocktail Coldrinks & Soda
- High Star Women Cotton Washed Mom Fit Casual High-Rise Jeans
- Ionstar 7.5 Kg Semi Automatic Washing Machine – 5 Star Rated – 2025 – Top Load – Jet Pulsator – Magic Filter – Special Air Dryer – Buzzer – Wheels – Powerful Copper Motor – 1500 RPM (STAR75-AQUA-G)
- LG 24U411A-B Smartchoice 60 cm (24-inch) Full HD (1920 x 1080) IPS Monitor, 3-Side Virtually Borderless, 1ms MBR, 120Hz, sRGB 99%(Typ.), HDR10, Reader Mode, Flicker Safe, VGA, HDMI, Slim Stand, Black
- Boat Airdopes 313, 13mm Drivers, Glide Shell, 75H Battery, 4Mics ENx Tech, Stream Ad Free Music via App Support, Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Gold Mist)
- acer EK240Y P6 P6 23.8 Inch IPS Full HD Backlit LED Monitor I 144Hz Refresh Rate, 1MS VRB Response Time, AMD FreeSync I 1 x VGA 1 x HDMI with Inbox HDMI Cable I Zero Frame Design I Eye Care I Black
- Zebronics HDMI 2.0 Cable with ARC, 4K@60Hz UHD, 3 Meter, 18 Gbps High Speed Data Transmission, Supports 3D, ARC, CEC, 32 Audio Channels, Male-to-Male (HAA3020A)
- Dabur Glucoplus C Instant Powder Energy Glucose (LemonFlavour) – 1kg | Replenishes Energy with 6 Added Vitamins and Minerals | 20% More Glucose In Every Sip | Vitamin C and Zinc Helps Boost Immunity | Calcium, Phosphorus and Vitamin K Support Bone Health
- Dabur Glucoplus C Instant Powder Energy Glucose (Mango Flavour) – 1kg | Replenishes Energy with 6 Added Vitamins and Minerals | 20% More Glucose In Every Sip | Vitamin C and Zinc Helps Boost Immunity | Calcium, Phosphorus and Vitamin K Support Bone Health
- Vishudh Women’s Kurta | Comfortable Ethnic Wear for Daily Use | Lightweight & Breathable Indian Top
- FABNEX Kurta Set for Women | Women Kurti Pant Set (K-53-54)
- Sotrue Dark Spell Liquid Eye Liner, Black, Long Lasting Matte Waterproof Liner – Quick Drying Smudge Proof,Fine Tip For Precise Smooth Application, Transfer Proof Eye Makeup for 24 hrs, 1.5ml
- GIGABYTE GS27FC 27 VA 1500R (Curved), 1920 x 1080 (FHD), 180Hz (Native), 79% DCI-P3 108% sRGB, 1 ms MPRT, 250 cd/m2 (TYP), FreeSync Premium, HDR 10
- Room Air Freshener Concentrate (makes 3 Liters Freshener) – Natural Essential Oil Based (Lavender+Rose+Lemon) with Reusable Spray Bottle. For Bedroom, livingroom, Bathroom and cooler perfume
- POND’S Dreamflower Floral Perfumed Powder With Glow-boosting Vitamin B3 For Women| Crafted With Superfine Minerals For Smooth Texture| Refreshing Long-Lasting Fragrance of Pink Lily| 300g
- Palmolive Aroma Morning Tonic Body Wash, Gel Based Shower Gel with 100% Natural Citrus Essential Oil & Lemongrass Extracts – pH Balanced, No Parabens, No Silicones, 750ml Pump
- Cloth for Cooking | Cotton Hand Towel for Drying Dishes | 70×45 cm Tea Towels | Highly Absorbent for Cleaning & Quick Drying of Plates| Kitchen Towel (Set of 4 Pieces), KTKT012
- Nykaa Wanderlust Japanese Cherry Blossom Deodrant
- 15th Birthday Decoration Items for Pink and White Theme Combination for Girls| 50 Pcs Pink White Gold Rose Gold Balloon| White Birthday Banner| Balloon Pump| Arch Tape| Glue Dots
- SECUREMENT® Honeycomb paper bubble wrap roll | Paper Bubble Wrap Roll for Packing, Shipping, Moving | Ecofriendly Paper Bubble Wrap | Expandable (15 inch x 10 Metre) – 10 Rolls
- Lakme Forever Matte Lipstick, Waterproof, Non Drying, Creamy Matte Bullet Lipstick Made With French Rose Oil Extracts, Purple Diamond, 4.5g
- Halonix Decorer Glowly Gold 15 Bright Led String Light | Diwali Light | Christmas Light | Wedding Light | Festive Lights for Home Decoration (Warm White, 4 Meters)
- 3M Engine Oil Additive, Effective Engine Lubrication and Power Transmission (50ml Each, Pack of 2)
- Pigeon 4.2L Digital Air Fryer with Silicon basket | 1200W | 360° Rapid Air Circulation | 85% Less Oil | 8 Preset Menus | Non-Stick Basket | Touch Control | Auto Shut-Off | 2Y Warranty
- Earth Rhythm Matte Mineral Sunscreen – 15gm
- TAG WM500 White/Grey Wireless Mouse, 2.4GHz USB Receiver, Dedicated DPI Button (800/1200/1600), 4 Buttons, Ambidextrous & Light, Power-Saving, 10m Range, 1x AA Battery, Supports Windows/Mac/Linux/iOS
- SELZER Instant Silver Cleaner Liquid for Jewellery – 250ml Silver Dip Stain Remover (250 ml)
- Acer Swift 2-in-1 Convertible 15.6 Inch Backpack | Sleek, Lightweight & Spacious Design | 11.5L Capacity | Convertible Design with Tuckaway & Removable Straps | Premium Metal Accents | (TAN)
- Indianara Set of 4 Motivational Quotes Paintings in Red Yellow Black White Frames (2120) without glass 9.5 x 9.5 inch each
- Magic Eraser Sponge | Pack of 5 | No Scratch Multi-Surface Cleaning Sponge | Removes Tough Stains | Just Add Water | for Walls, Kitchen, Bathroom, Shoes, Switch Boards & Utensils
- Dettol Neem Bathing Soap Bar With Pure Neem Oil, 75G (Buy 3 Get 1 Free), Combo Offer On Bath Soap
- ZEBRONICS Bro in Ear Wired Earphones with Mic, 3.5mm Audio Jack, 10mm Drivers, Phone/Tablet Compatible (Black)
- Fastrack Limitless FS2 Pro Smartwatch|1.96″ Super AMOLED Arched Display with Functional Crown and Resolution of 410X502|Singlesync BT Calling|Nitrofast Charging|110+ Sports Modes|200+ Watchfaces,Wine
- Halonix 5W 1Ft Streak Square cool White pack of 2, Cool day Light
- Halonix Prime 12W B22D Inverter Rechargebale Emergency Led Bulb (Pack of 1, White)
- Little’s Soft Cleansing Baby Wipes Lid Pack (80 Wipes)
- Redgear Turbo F-1 Case Cooling Fan with auto RGB for PC
- Park Avenue Men Regal No Gas Premium Perfume Long Lasting Citrus Fragrance Spray 130Ml (Pack Of 2), Pack Of 1
- Philips 20W Ujjwal LED Batten, LED Tubelight for Home, Cool Day Light, Pack of 4
- ATHENA LIFESTYLE Black Solid Ribbed Bodycon Dress
- adidas Men Vigorcwalk M Walking Shoe
- ToyBharat Press n go Dino Cars with Whistle Music for Toddlers, Friction-Powered Dino Cars, Mini Press & Go Vehicles, Montessori Educational Toy for Boys & Girls
- L’OREAL PARIS Unscented Hyaluron Pure 72H Rehydrating Conditioner for All Hair Types For Smooth Tangle-Free Hair, 175 Millilitres
- Goldmedal ORYZO BLDC 1200mm BEE Certified 5 Star Rated Ceiling Fan For Home and Office | Remote Control | Anti Dust | Smooth & Silent Operation (Granite Grey)
- Pigeon Stark Therminox 1000 ml Steel Flask (Pack of 1, Silver)
- Nycil Germ Expert Cool Herbal Prickly Heat and Cooling Powder – 400 g | Get Relief from Skin Problems
- Crompton Laser Ray Neo 1 Feet 5W LED Batten| Energy Efficient Batten for Home | Cool Daylight | Pack of 2
- Tokyo Talkies Women’s Straight Fit A-Line Skirts | Strachable Skirts| Mid-Rise| Women Skirt | Skirt for Women
- ACTION Extra Soft Men’s PILO Comfort Slippers | Lightweight & Anti-Skid Flip Flops with Cushioned Footbed | Waterproof Slippers for Men & Boys – ART APTM-26
- Mivi Fort Q350 Soundbar with 350W Surround Sound, 2.1 Channel soundbar with a Wireless External subwoofer, Multiple EQ and Input Modes, Remote Accessibility, BT v5.3, Made in India Sound bar for TV
- OPEN SECRET High Protein Oats Healthy Breakfast Mix of Protein & Fibre 0 Refined Sugar Pouch (1 kg)
- Electric Belly Fat Burner Belt with Handheld Fascia Ring – Wearable Vibration Body Shaper with Heat, Adjustable Strap, Digital Display & USB Charging for Waist, Abdomen, Back Fitness Use
- Nivia Storm 2.0 Football | Rubberized Moulded | Suitable for Hard Ground Without Grass, Wet & Grassy Ground & Artificial Turf | Training Ball | for Men/Women | Football Size – 5 (White/Blue)
- Forest Found Roasted & Salted Edamame (300g) Beans | 46% High Protein & 14% Fiber | Oil-Free Vacuum Roasted Crunchy Seeds | Low Carb, Plant-Based Protein Healthy Snack | Young Green Soybeans
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 17th May 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 17th May 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 17th May 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato