Pages
- Best Laptops Deals October 2026
- Best Smart Watches October 2026
- Mobiles
- Amazon Deals & Offers for October 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 11th October 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Logitech MK240 Nano Wireless USB Keyboard and Mouse Set, 12 Function Keys 2.4GHz Wireless, 1000DPI, Spill-Resistant Design, PC/Mac, Black/Chartreuse Yellow
- Lenovo Yoga Slim 7 Smartchoice Aura Edition Intel Evo Core Ultra 7 256V (16GB RAM/512GB SSD/14 (35.5cm)/WUXGA OLED/Copilot+ PC/Windows 11/MSO 365 Basic+Office 24/Seashell/1.19Kg), 83JX00H2IN AI Laptop
- PHILIPS Sky 5W Rechargeable Touch Controlled LED Table Lamp | Desk Lamp with Brightness Control 9-Watts E27 LED Warm White LED Bulb, Pack of 1, (Ace Saver)
- French Connection Men Analogue Automatic Gray Dial Watch-FCA20GNM
- Horlicks Nutrition Drink Container – 1 Kg – Classic Malt – Clinically Proven to make kids Taller, Stronger, Sharper
- XIAOMI Sound Outdoor Speaker (Green) | |30W Hi-Quality Speaker with Mic|Upto 12hrs Playback Time|IP67 Waterproof & Type C|Wireless Stereo Pairing| Outdoor & Travel Purpose
- boAt Type A to C 65W Fast Charging Cable with 480 Mbps Data Transfer, Tangle-Free Cable in Premium Nylon Braided Design & Durable Aluminium Alloy Shell (Electric Blue)
- Adrenex Stryker 26T | 85% Pre- Assembled | 26 T (inch) Mountain Cycle (Single Speed, Blue, Black, Rigid)
- Xiaomi 80 cm (32 inch) Smartchoice F Series HD Ready Smart LED Fire TV L32MB-FIN
- Zebronics UCLC65B 65 Watts PD Fast charging 4 in 1 cable with USB/Type C to Type C/Lightning connector, 1 meter braided cable for smartphones tablets and Laptops
- Himalaya Refreshing Body Lotion, Aloe and Cucumber, 200ml
- Rexona Advanced Brightening Roll On Motion Activated Deodorant for Women | 72-Hour Freshness | 45 ML
- Kingsway kkmbgch00181 Car Bumper Guard for Jeep Compass (Set of 4, Chrome)
- Allen Cooper Training,Road Running,Cricket,Gym,Sports Comfortable Extra Max Cusion with Memory Foam Insole Running Shoes for Men(509 | Navy | Size-6,7,8,9,10)
- PHILIPS BT1245/18 Trimmer 30 min Runtime 3 Length Settings (Blue)
- Whisper Super Absorbent Period Panty, 12 M-L Pants, 360 Degree Leakage Protection* for Heavy Flow, Panty like Fit, Full back Coverage, Absorbs Heavy Gushes, Silky Soft, Comfortable Feel
- Odour Block with Lemon Shield I Anti-Perspirant Deodorant Roll-On| Body Deodorant Roll-On For Men & Women| 48-Hour Active Sweat Protection| Alcohol-Free | 50ml
- Santoor PureGlo Glycerine Soap with Almond Oil and Glycerine, 125g (Pack of 6) for Nourished Glowing Skin
- ZEBRONICS Mercury Premium Gaming Chassis with Support for mATX | Mini ITX | 240mm AIO, Dual Chamber Design, Infinity Ring ARGB Fan, Wraparound Tempered Glass (White)
- FUTOPIA 23.8″ Full HD IPS All-in-One Desktop | Intel Core i5-14400 (Up to 4.70GHz) | 16GB RAM | 512GB NVMe SSD | Pop-up FHD Webcam | Wi-Fi 6 | Windows 11 Pro | Keyboard & Mouse Included
- BERGNER Master Pro Nylon Potato Pav Bhaji Masher for Kitchen (Black)
- Snowberry Plastic Grocery Container – 1200 ml, 650 ml, 350 ml, 250 ml (Pack of 20, Silver)
- Colgate MaxFresh Toothpaste, Blue Gel Paste with Menthol for Super Fresh Breath, 600g, 150g X 4 (Peppermint Ice, Combo Pack)
- Doctor Health Super Soft Newly Launch | Classic Ultra Soft | Cushion | Comfortable|Premium|Stylish|Trendy Women Slides (Multicolor , 4)
- Kozicare Neem Tulsi Soap with Kojic Acid Pack of 3 – Detan Bathing Bar for Glowing Skin – Brightening Cleansing Bar for Men and Women All Skin Types
- ATTRO Tasty Bite 3 Compartment Lunch Box with Small Container & Spoon BPA Free Food Grade Leak-Proof Microwave Safe Ideal for Kids-1020ml+70ml Peach, Plastic
- SleepyHug Ortho Spinex Plus | Aircell Technology | 4 inch HR Foam Mattress for Back Pain Relief & Spine Alignment | 5 Years Warranty | King Bed Size | Blue | (LxW- 72×72 Inches)
- Born Good Plant Based Dishwash Gel 3Ltr, Spanish Citrus Fragrance, Eco-Friendly, Non-Toxic, Biodegradable
- LIKEPRO Kit Set of 4 – Weightlifting Belt, Wrist Wraps, Lifting Straps & Figure 8 Straps Weight Lifting Belt (Black)
- Yardley London Gentleman Classic Activated Charcoal Men’s (4 x 100 g)
- SANDISK 2TB Portable SSD, 800MB/s R, USB 3.2 Gen 2, Rugged SSD with Upto 2 Meter Drop Protection, Type-C to Type-A Cable, PC & Mac Compatible, 3 Y Warranty, External SSD (SDSSDE30-2T00-G26)
- BSB HOME Ultrasonic Quilted AC Comforter 220 GSM|Premium Microfiber Reversible All Season Blanket for Double Bed | Ultra Soft Lightweight Quilt Duvet | 225 x 220 cm (Red & Offwhite)
- Blue Star 1.45 Ton 5 Star,New Star Rated, Wi-Fi Smart Inverter Split AC (Copper, AI Pro+, 4-Way Swing, DigiQ Hepta Sensor, Blue Fins,Turbo Cool, Self Clean Technology (IC518ZXUS, White))
- Cortina Large Travel Makeup Bag & Cosmetic Organizer for Women, Light Blue
- BSB HOME 240 TC Cotton Double Bedsheet with 2 Pillow Covers, Soft & Breathable Bed Sheet for Double Bed, Fade & Wrinkle Resistant, Floral Print, 90 x 100 Inches (228 x 254 cm)-Mineral Gray Botanical
- Reebok Mens Running Shoes Sneaker
- Kellogg’s Millet Muesli with 84% Fruit, Seed & Multigrain| Power Breakfast | No Maida No Palm Oil | India’s No 1 Muesli | 500g
- Fastrack Vibes polarized UV protection smart Sunglasses with music, taking phone calls, and get navigation updates via built-in Bluetooth speakers (Medium)
- Bombay Dyeing Florentine Floral Green Super King Size Bedsheet Set (3 Pc)
- Colgate Charcoal Clean Black Gel whitening Toothpaste, 480 gm (120g x 4), Bamboo Charcoal and Wintergreen Mint for a Clean Mouth Experience
- Ant Esports Tenkeyless Keyboard Wrist Rest Pad -14.3″- Memory Foam Palm Rest with Non-Slip Footpad – Ergonomic Design Wrist Support – Desk Keyboard Accessory Gaming Gear- -TKL Size Black
- BOSCH GSB 600 Impact Drill Machine for Home & Wall | 600W Motor | 13mm Chuck | 3000 RPM | 48000 BPM | Variable Speed | Double Insulation | 1 Year Warranty
- Mizu Exel 7 Steps Ladder For Home With Aluminium Steps & Upto 300 Kgs Load Capacity Steel Ladder (With Platform)
- Dabur Red Gel Ayurvedic Toothpaste – 600g (150g x 4) | Reduction in Bad Breath, Plaque & Gingivitis | Freshness with Protection | For Healthy Gums & Effective Dental Care
- Saffola Oats High Protein -21g |High fibre | Instant rolled oats | Soft & Creamy Pouch (1 kg)
- Footloose by VIP Head Spin 8-Wheel Cabin Hard Case Trolley Bag, Green
- VAS COLLECTIONS Premium Chenille Carpet | 500 GSM Velvet Carpet/Area Rug/Durries with Fine Gold Yarn for Living Room, Bedroom, Runner| Blue, 5×7 Feet
- Buckle-Free Elastic Waistband Belt Set of 2, Adjustable Metal Hook Stretch Straps, Invisible Belt Alternative for Jeans, Pants and Work Trousers for Men and Women
- Ant Esports MK1200 Mini 60% Wired Mechanical Gaming Keyboard – Red Switch, Rainbow Backlit, 61 Keys, Anti-Ghosting, USB, Compact TKL – Compatible with Windows, macOS, PS5, Xbox, Laptop & PC (White)
- Gigabyte B650 UD AC
- Kellogg’s Millet Muesli with 84% Fruit, Seed & Multigrain| Power Breakfast | No Maida No Palm Oil | India’s No 1 Muesli | 1000g
- ASUS Rog Strix B760-I Gaming WiFi Intel B760(13Th&12Th Gen) Lga 1700 Mini ITX Motherboard,8 + 1 Power Stages,Ddr5 Up to 7600 Mt/S,Pcie 5.0,2Xm.2 Slots,WiFi 6E,USB 3.2 Gen 2X2 Type-C,Aura Sync RGB
- Axe Signature Champion No Gas Body Deodorant Bodyspray for Men 154 ml
- NIVEA Soft Hydration+ Serum Infused Gel Moisturizer for Plump & Bouncy Skin | Face Cream with Hyaluron & Niacinamide | 100Hr Hydration | Quick Absorbing Moisturiser for All Skin Types | 300ml
- LuvLap Baby-Boys Baby and Toddler Sweatshirt Set
- boAt Airdopes Prime Supreme,Spatial Audio,60H Battery,Quad Mic,ENx,ASAP Charge,BTv6.1 Bluetooth Headset (Ivory Dust, True Wireless)
- Parachute Advansed Honey Soft Body Lotion, With Honey, 100% Natural, Dry Skin Moisturizer, Silky Smooth Skin, 225ml
- BlissClub Womens The Ultimate Capris, 3/4th Length Pants, Super- High Waist, 2 Pockets, Wide Waistband, Activewear for Women
- Maharaja Whiteline 500W Mixer Grinder with 3 Stainless Steel Jars with lid and 20,000 RPM Motor Speed (White & Cherry Red)
- Lenovo Smartchoice ThinkBook 14, Core Ultra 7 255H, 16GB RAM, 512GB SSD, WUXGA IPS 14”(35.56cm), Win11, Arctic Grey,1.36Kg, 21SJA0KBIG, Fingerprint, Backlit, 300 Nits, 1Y Warranty, AI Powered Laptop
- Samsung Galaxy S25 Ultra 5G AI Smartphone (Titanium Black, 12GB RAM, 256GB Storage), 200MP Camera, 5000mAh Ultra Long Battery, QHD+ Dynamic AMOLED 2X, Galaxy AI, Knox Security, S Pen Included
- Fastrack Men Stunners Quartz Analog Blue Dial Silver Metal Strap Watch – 3278SM03
- TIMEX Analog Watch for Men with Round Dial & Water Resistant Man’s Wrist Watches
- Clinic Plus Strong & Long Shampoo 1 L|| With Milk Proteins & Multivitamins for Healthy and Long Hair – Strengthening Shampoo for Hair Growth
- Mamaearth Rice Water Hydrating Body Lotion with Rice Water & Niacinamide for Dewy Glass Skin 600ml | 48H Moisturization | Nourishes Skin | 7in1 Total Care | 100% Natural Butter | Non Greasy Smooth
- Flipkart SmartBuy Column Floor Lamp
- Himalaya Neem & Turmeric Soap, 75g (Pack of 4)
- Parachute Advansed Radiant Shine Hair Serum, Coconut & Almond, 48Hr Frizz Control, 10X Strong Hair (100 ml)
- Havells REO Vaayu 1200mm ES Ceiling Fan | High Speed, High Air Delivery | Strong & Powerful, Air Delivery: 220CMM| RPM: 370| 2 Year Warranty | (Pack of 1, White)
- Bambalio BSNS-10A Arrow Shaped 5 inch,5 Neon Colour Prompts, 25 Sheets/Prompt,Pack of 3
- Orient Electric Newly Launched 1200 mm Proton BLDC | BLDC energy saving ceiling fan with Remote |BEE 5-star rated | Saves up to 50% on electricity bills | 3 year warranty by Orient | White
- Greenchef Rio Tawa 25 cm diameter (Aluminium, Non-stick)
- 75% Off on Men’s Jeans
- Acer Iconia Tab iM11 8 GB RAM 128 GB ROM 10.95 inch with Wi-Fi+5G Gaming MediaTek 8755 CPU – Octa core Up to 2.4 Ghz Tablet (Slate Grey)
- Biotique Wheat Germ Anti- Ageing Night Cream | Reduces Fine Lines | Lightens dark Spots | 100% Botanical Extracts | Suitable for All Skin Types | 50g
- Biotique Honey Gel Soothe & Nourish Foaming Face wash | Soap Free Formula | Reduce Dryness | 100% Botanical Extracts | Suitable for All Skin Types | 200ml
- Sanjeev Kapoor Collection Beer Mug, Set of 2, 360 ml Each, Transparent Glasses for Beer, Drinks, Cocktail
- BUZZ Standard Men Athleisure Slim Fit Solid Cotton Joggers Zipper Pockets, Ultra Soft, Stretchable, Breathable, Anti-Slip Waistband with Drawcord, Track Pants for Leisure, Travel, Workout. Pack of 1
- MOTOROLA AmphisoundX Vibe 50 W Bluetooth Soundbar (Black, 2.1 Channel)
- L’Oréal Paris Permanent Hair Colour, Radiant At-Home Hair Colour with up to 100% Grey Coverage, Pro-Keratin, Up to 8 Weeks of Colour, Excellence Crème, 5 Light Brown, 72ml+100g
- L’Oréal Paris Total Repair 5 Shampoo 650ml + Conditioner 175ml + Serum 40ml (3 Items in the set)
- VAS COLLECTIONS Cotton AC Blanket for Single Bed (152 x 225 cm) | Reversible Soft Lightweight All-Season Blanket | Skin-Friendly & Breathable Comforter (Golden Leaf Garden)
- Pigeon by Stovekraft Nutriblender + Tesla Electric Kettle 1.5L
- Biotique Fruit Brightening Face Wash| Ayurvedic and Organically Pure| Advanced Swiss Technology |100% Botanical Extracts| Suitable for All Skin Types | 200mL
- Vaseline Intensive Care Cocoa Radiant Body Oil | With Cocoa Butter | Non-Greasy Formula for Dry Skin | 200 ML
- Parachute Advansed Honey Soft Body Lotion, With Honey, 100% Natural, Dry Skin Moisturizer, Silky Smooth Skin, 400ml
- IFB 206L 5 Star Advanced Inverter Direct-Cool Single Door Refrigerator with 30 Hrs Cooling Retention, Big Vegetable Box, 4 Year Super Warranty & Base Stand (2026, IFBDC-232EYOSED, Onyx Grey)
- boAt Airdopes Supreme w/ 4 Mics AI ENx Tech, 50 HRS Playback,Multi Point Connectivity Bluetooth Headset (Classic Black, True Wireless)
- GOBOULT W20 with ENC Mic, 40Hrs Battery Life, Low Latency Gaming, 5.3v Bluetooth Headset (Glacier Blue, True Wireless)
- TRIGGR Rizz with 40H Playback, Spherical Design, 13mm Drivers, Rich Bass, Fast Charging Bluetooth Headset (Onyx Lilac, True Wireless)
- HEAD & SHOULDERS Cool Menthol 2-in-1 Anti-Dandruff Shampoo + Conditioner for All-Hair Types (650 ml)
- CELLO Unity Whiskey Rocks Glass Set of 6 Pcs, 215 ml Transparent | Leadfree Freezer & Dishwasher Safe, Toughened Glass Set for Bar, Liquor, Whiskey, Cocktail, Mocktail, Mojito & Cold Beverages
- ATTRO Smart Lock Fridge Containers PET Plastic Jars Airtight Lids Multi-Purpose Kitchen Organiser for Pulses Cereals Spices & More – Black- Set Of 3-350ml, 750ml, 1500ml
- HP Smartchoice Victus, AMD Ryzen 7 7445HS, 6GB RTX 3050, 16GB DDR5(Upgradeable) 512GB SSD, 144Hz, 300 nits, 15.6”/39.6cm, Win 11, Office 24, Blue, 2.29kg, fb3134/20ax, Xbox Gamepass*, Gaming Laptop
- Cello Puro Steel-X Benz 900 | Leak Proof| Wide Mouth & Easy to Open | Insulated Inner Steel Outer Plastic Water Bottle | 650 ml | Turquoise
- Shocknshop Analog Square Dial Unisex Silver Stainless Steel Watch for Men and Womens -WCH130
- Attro O2 Spring 1000ml Water Bottle with Easy to Carry Handle Leak-proof BPA Free Plastic Material- Set of 2 Blue
- Treo by Milton Cove Ceramic Mug 200 ml I Microwave, Dishwasher Safe I 100% Food Grade I Stain, Odor Resistant I Coffee Mug, Tea Cup I Ideal for Daily use, Gifting, Set of 6, Grey
- CabONE Lite 2.5 Sqmm CCA Copper Wire | 90m | Single Core | FR PVC Insulated | Domestic 2.5 sq/mm Red 300 ft. Wire (Red)
- Jeewan Kamal Aloe Vera Gel for Face, Skin & Hair, 300g, Herbal, Natural, Moisturising, Soothes Sunburn, Acne & Dandruff | Non-Sticky, Hydrating Gel (Pack of 1)
- WellFarm Lakadong Turmeric Powder From Meghalaya, Organic Haldi Powder, High Curcumin Turmeric Powder, 200gm
- Natural Multani Mitti Powder – 250g | Pure Fuller’s Earth & Bentonite Clay for Glowing Skin, Deep Cleansing & Hair Care | Natural Multani Mitti Face Pack for Smooth, Nourished Skin
- WellFarm Halim Seeds for Eating 250g | Garden Cress Aliv Seeds | Hygienically Packed | Raw and Natural | Halim Seed Used in Cooking, Baking, Smoothies and Other Beverages and Hair Growth
- WellFarm Premium Natural Chia Seeds Jar 250g | Edible Salvia Hispanica Seeds | Rich in Protein & Dietary Fibre | Plant-Based Superfood | Suitable for Smoothies, Yogurt, Salads, Baking & Healthy Recipes
- BENAVJI Traditional Floral Printed Carpet Rug for Living Room | Soft Floor Mat with Decorative Tassel Border | Anti-Skid Multipurpose Area Rug for Bedroom, Hall & Home Décor Pack of 1
- Maybelline New York Superstay Matte Ink Liquid Lipstick, Warrior
- Olay Regenerist Micosculpting Day Cream | Hydrated, Plump, Bouncy Skin | with Hyaluronic Acid, Niacinamide and Peptides | Normal, Oily, Dry, Combination | 50g
- LuvLap Baby Wash & Shampoo -400ml, Milky Soft Head to Toe Wash With Oatmeal & Shea Butter, Paraben Free, Tear Free, Rich Moisturised Skin & Soft Hair, 2 in 1 Baby Body Wash, Dermatologically Tested
- Tokyo Talkies Women Tops
- Highlander Men’s Cargo Jogger Trousers| Utility Pockets | Trouser for Men | Men Trousers
- boAt 12 W 2.4 A Wall Charger for Mobile (Crystal White)
- Crompton Laser Ray Smile 20W LED Batten |4 feet Slim Batten for Living Room & Bedroom | Energy Efficient Tubelight for Home | BIS Approved | Natural White (6500K) (Pack of 1)
- Symbol Men Festive Solid Long Kurta (Regular Fit)
- Maybelline New York Fit Me Matte + Poreless Compact Powder, 128 Warm Nude
- Sanfe CocoGlow Soap for Cleansing & Moisturizing | Coconut Oil & Shea Butter | Helps Reduce Dullness & Leaves Skin Soft & Nourished | Daily Bath Soap | For All Skin Types | 75 g
- Himalaya Herbals Neem and Turmeric Soap, 125gm (Pack of 4) with Value Pack Save Rs.20
- Nature Purify Premium Afghani Anjeer 1KG | Dried Figs | Natural Anjir Whole Fruit | Soft Chewy Texture & Sweet Taste | Nutritious Dry Fruit for Snacking, Baking, Desserts & Festive Gifting
- Shiv Textiles Women’s Polyester Solid Trackpant (Pack of 3 Track Pant)
- AO Smith Z9 Pro Black RO Water Purifier For Home | Ambient & Instant Hot | Copper + Alkaline Water Filter | 100% RO Purifier with Silver Sheild | 10L Storage
- Havells Trim Surface Panel 7W RD 3IN1
- Clay Craft Fine Ceramic Armada Microwave Safe Coffee & Milk Mug, 320Ml, 1 Piece, Lilac, Mug for Coffee, Ideal for Gifting, Perfect for Home & Office
- Santoor Refreshing Body Wash Shower Gel With Natural Lemon & Frangipani Extracts| For Men & Women| For Soft and Fresh Skin| Suitable For All Skin Types| No Parabens| No Silicones| 500ml
- PYORIT Heavy Duty Hooks for Hanging Keys Coats Hats Bags Ceiling Kitchen Accessories Hook 50 (Pack of 50)
- Hero MotoCorp Pleasure+ 110 VX Drum Brake OBD2B TEAL BLUE Booking for Ex-Showroom Price
- Lifelong Coccyx Cushion, Donut Pillow for Tailbone Pain Relief, High-Density Foam, Standard Size, Mesh Grey & Black
- L’Oréal Paris Hyaluron Pure 72H Purifying Shampoo, 340ml
- BENAVJI Traditional Floral Printed Carpet Rug for Living Room | Soft Floor Mat with Decorative Tassel Border | Anti-Skid Multipurpose Area Rug for Bedroom, Hall & Home Décor Pack of 2
- Air Affair AQUATIC DRAKKAR Car Freshener Diffuser Luxury Car Perfume | Long Lasting Fresh Aquatic Fragrance (10 ml)
- Baidyanath Asli Ayurved Diabo Vital Juice | Herbal Blend with Karela, Jamun, Neem & Gudmar | No Added Sugar, Flavours or Colour |1Liter
- Baidyanath Asli Ayurved Isabgol Orange flavour- Psyllium Husk Powder 200gm | Boosts Digestion | Constipation Relief Naturally | Rich Source Of Dietary Fiber Supplement
- MarwarBites Dried Afghani Anjeer | Figs Ajnir | Rich source of Fibre Calcium & Iron | Low in calories and Fat Free | Non-GMO Dried Figs | 500gm
- VASELINE Sun Protect SPF 50 PA++++ Lotion, 400ml, for Skin Protection from Harsh Sun, with Niacinamide, Vitamin C & E, Reduces Tan Lines, Non-Sticky and Lightweight, for Men & Women
- LOTUS HERBALS Skin Whitening& Brightening Hand&Body Lotion SPF-25|PA++++ (800 ml)
- CELLO Midas Casserole Hot Pot Box for Daily Use & Kitchen 1500 ml, Black | BPA Free Serving Inner Steel Insulated Food Grade Airtight Sturdy Handle Casseroles Case Set for Roti Chapati Rice Biryani
- Himalaya Lip Balm 10gm| Soft| Naturally Pink Lips| Made with 100% Herbal Actives
- Dove Renewing Raspberry Body Wash with Lime for Renewed Skin, Refreshing Scent, 1L
- Dove Nourishing Body Wash for Sensitive Skin, 24Hrs Moisture Lock, 1L
- Parachute Advansed Gold Coconut Hair Oil, 400ml
- Maybelline Superstay Vinyl Ink Liquid Lipstick, Lippy
- Raymond Home Microfiber Double Flat 110 TC Floral 1 Bedsheet (Multicolor)
- Newleaf Premium Baby Wipes | 99% Pure Water, Aloe Vera & Glycerine with Lid, Pack of 12 (864 Wipes)
- Orient Electric Apex-FX 1200mm Ceiling Fan for Home| BEE 1 Star Rated Energy Efficient Fan| Rust Resistant | Strong and Powerful Motor | 2 Years Warranty by Orient | White – Pack of 1
- boAt 2026 Launch Airdopes Joy v2, 35H Battery, Pocketable Design, ASAP™ Charge, 13mm Drivers, Easy Touch Controls, ENx™ Tech, IWP™ & App Support TWS Bluetooth Earbuds with mic (Cloud White)
- Prestige 500W Nexus Mixer Grinder with 3 Stainless Steel jars|1200ml Wet Jar,800ml dry jar, 400ml chutney jar|3 Super-efficient Blades|3 motor setting|Sturdy Handles |2 Yrs Warranty|White & Rose Gold
- ZEBRONICS Poise Rechargeable Wireless Mouse, Dual Mode (2.4GHz + BT), Upto 1600 DPI, Silent Operation, 4 Buttons, Comfortable & Ergonomic, for Mac | Laptop | Computer (Metallic Black)
- Cureveda Himalayan Shilajit For Men Resin 10 gm
- Pure Original Kashmiri Saffron POWDER/Kesar/Kumkuma Puvvu (5 gm) | Certified highest Grade-A Keshar | Saffron for Lassi, Pooja rituals, Biryani, Milk, Sweets
- Nothing Phone (4b) (Blue, 128 GB) (6 GB RAM)
- Wickedgud Whole Wheat Masala & Curry Noodles 240g Pack of 2| No Maida | No Palm Oil | Source of Protein
- WickedGud Masala Noodles (69g x 6) – Whole Wheat, Zero Maida, No Palm Oil
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Who was the top scorer for India in the T20 World Cup final 2024?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 11th October 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 11th October 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 11th October 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbabydodiedobajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdecathlondistrictdmartDomino'sdroomeazydinerelementsepicgamesfastandupfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsyskyscannersnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato