Pages
- Best Laptops Deals October 2026
- Best Smart Watches October 2026
- Mobiles
- Amazon Deals & Offers for October 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 31st October 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Crackles Unicorn Stationary Kit with Pencils, Erasers, Sharpener, Ruler Bookmark, Pencil Grip Combo Set for Best Return Gift
- Kraft Seeds 10CLUB Decorative Metal Planter with Stand | Rust-Free, Drainage Hole | Indoor/Outdoor | Medium (13 x 13.5 x 12 cm) | Gold and Black | Set of 2
- Medimix Ayurvedic Body Wash, Sandal with Eladi Oil for Clear, Glowing and Tan-Free Skin 250ml + 50ml | Herbal Shower Gel | Paraben-Free & Sulphate-Free
- TRESemme Bondplex Sleek Shampoo 1000ml With Salon-Inspired Protein Bonding Complex | Repairs Damaged Hair | Restores Hair Strength
- Vector X Maestro 3D Texture TPU Fusing Upper with TPU Sole, Primeknit Sock for Grip, Soccer Football Studs,Durbale, Lightweight
- Nat Habit Curry Cider Nutri-Conditioner for Dry & Frizzy Hair | Natural Hair Conditioner for Women & Men Anti Hairfall | Keeps Hair Frizz-free, Bouncy, Strong, Shiny and Hydrated, 150ml
- HALONIX 480 LEDs 10 m Multicolor Flickering Strip Rice Lights (Pack of 4)
- Ichaa Women Night Suit Set
- Ichaa Women Night Suit
- Himalaya Men Pimple Clear Neem Face Wash, 100ml
- Neelam Stainless Steel Dinner Set (Set of 36 Pcs Diamond)
- Livon Professional Smoothening Serum for Women & Men | For Smoother, Stronger & Frizz-Free Hair | With Vitamin E, Avocado & Almond Oil | No Paraben, Sulphate or Mineral Oil | All Hair Types | 45ml
- Little’s Soft Cleansing Baby Wipes with Lid | 80 Wipes x Pack of 4 – 320 Wipes | Extra Thick & Moist Wet Wipes for Baby’s | Prevents Rashes & Redness with Goodness of Aloe Vera, Vitamin E & Jojoba Oil
- HIRA Love Letters Perfume for Women | Fruity Floral Vanilla EDP 50ml
- Van Heusen Boys Anti Bacterial Trunks – 100% Super Combed Cotton – Pack of 2 – Colour Fresh, Moisture Wicking
- Vim Floor Cleaner: 1000ml |Refreshing Lemongrass with Salt|100% Removal of stains for complete clean floors & long lasting fragrance
- GNC Men’s Energy, Immunity & Performance Trio | Multivitamin with 32 Premium Ingredients (30 Tablets), Fish Oil 1000 Mg (60 Softgels) & Triple Ginseng Root (60 Capsules), 170 grams
- My First Book of Patterns – Pencil Control (Spanish Edition) Tracing and Patterns for Beginners | Improve Pencil Control and Hand-Eye Coordination | Ages 2–5 | 1.5 Hours of Educational Fun
- Centrino Sandals for Men |Comfortable Sandals with Grip Insole & Quality|Flat Casual Sandals With Adjustable Velcro Closure For Easy Wear With Flexible Fitting And Trendy | Stylish Men’s Casual Sandal With Unique Sole Design for Office & Travel (3263)
- GOBOULT Mustang GT 20, Dual Dynamic Drivers, RGB LEDs, Bass Radiator, BTv 6, 7Hr Battery 20 W Bluetooth Speaker (Turbo Black, Stereo Channel)
- Bournvita Zero Added Sugar Nutrition Drink, 500g Jar | No Added Sugar, No Added Preservatives | 19 Essential Nutrients for Strength
- Lizol Shakti 900ml (Pack of 2)- Aqua Fresh Floor Cleaner| 2X Better Cleaning vs Phenyl |Kills 99.9% Germs| Removes Tough Stains| Suitable for All Floor Cleaner Mops
- Poshan Veda Slim 365 Weight Loss Atta | High Protein & High Fibre Low GI Multigrain Flour | Soft & Fluffy Rotis for Belly Fat & Healthy Weight Loss, 500 gram
- Henko Matic Top Load Detergent Powder 4KG + 2KG | Lintelligent Nano Fibre Lock Technology, Removes Toughest Stains From Your Clothes, Locking Fibres & Color Intact
- ALOXE Premium Large Makeup Organisers | Upgraded Storage Box and Organiser with Drawers for Dressing Table, Skincare, Makeup Storage & Accessories (White)
- Mini Pocket Printer,Portable Thermal Printer for Label,Text Memo,Receipt,Sticker,Photo Printers, BT Inkless Printing, Wireless Bluetooth Printer Compatible with iOS and Android (Pink)
- Kitchen Shears – Heavy Duty Stainless Steel Scissors with Protective Covers, Sharp & Sturdy, Dishwasher Safe Food Shears for Chicken, Poultry, Fish, Meat, Herbs & BBQ – For Home [ 1-pcs ]
- GRAPHENE Remote Control Car RC 4X4 Double Smoke Hand Sensor Extreme Drift Car Toy for Kids Boys Adults Gesture Control Sports High-Speed Racing 360° Rotating Stunt RGB Lights Spray Mist 4-14 Years
- Himalaya Anti-Hair Fall Cream | Reduces Hair Fall & Improves Hair Conditioning | Non Sticky Oil Replacement Hair Cream | With Bhringraja & Amla | For Women & Men | 100ml
- Beardo Max Cooling Gel Sunscreen SPF 60+ PA++++|UVA/UVB Protection | No White Cast |Ultra Lightweight Texture | Non-Greasy |Sunscreen for Men-10g
- Clovia Women’s Cotton Printed T-Shirt & Basic Pyjama Set – Black
- MMTC PAMP 24K 999.9 Purest Goddess Lakshmi Gold Pendant, 2 Gram gold bar & coin, LBMA Certified
- ZEBRONICS Zeb-Juke BAR 9500WS PRO Dolby 5.1 Soundbar with Wireless Satellites, Dolby Audio, 525 Watts Output Power, 16.5cm subwoofer, HDMI ARC, BT v5.0, LED Display, Wall Mount and AUX (White)
- RJ 22W Black LED Ceiling Light | 3 Colour in 1 – Warm White, Natural White & Cool White | Modern Black Surface Mount Ceiling Lamp for Bedroom, Living Room, Kitchen & Balcony | 2 Year Warranty
- Trance Home Linen Premium Bamboo 100% Waterproof Mattress Protector | Hypoallergenic Breathable Elastic Fitted Mattresses | Bed Cover Queen Size (78×60 inch | 6.5×5 ft, White)
- Btag Stainless Steel Non-Scratch Dish Cleaning Cloth | Reusable Wire Scrubber for Tough Grease on Utensils, Sinks & Counters | Wet & Dry Cleaning, Pack of 5
- Vector X Waterproof Portable Multicolour Treking/Capmping/Outdoor Dome Camping Tent for Travel,Picnic,Hiking, Trekking Portable Big Dome Tent House Inflatable Tent for Camping (200 x 120 x 105 cm)
- Kapiva Certified A2 Gir Cow Ghee 500ML | Traditional Vedic Bilona Method | Grassfed, Pure & Healthy | Curd-Churned | Premium Glass Bottle | Lab-Tested | Rich in Nutrition
- Haier Smart Choice 596L 3 Star Frost Free Expert Inverter Smart Sense AI enabled 2-Door Side by Side, In-built Water Dispenser Refrigerator (HRS-682WGKU1, Graphite Black, Magic Convertible,2026 Model)
- Haier 596 L 3 Star Frost Free Expert Inverter 2-Door Side by Side Refrigerator (HES-690SS, Shiny Silver, Magic Convertible, Deo Fresh Technology, 2026 Model)
- Desidiya® Diya LED Hanging Light | Warm White Double-Sided Festival Décor
- Desidiya® Happy Diwali LED Hanging Light | Warm White Double-Sided
- Exotic Aromas Essential Oil Pack of 15 Lavender Rose Sandalwood Jasmine Orange Rosemary Lemongrass Ylang Ylang Tea Tree Peppermint Eucalyptus Lemon Frankincense Vanilla Citronella
- Oshea Colors Glossy & Chip Resistant Nail Polish | Long Lasting Nail Enamel with Metallic Shine & Flawless Finish 98- Lovel 10ml
- Cockatoo Rain-Guard Automatic Umbrella With 8 Ribs, Material- Polyponee, Umbrella For Women & Men, With Auto Open-Close Button
- The Man Company Blanc No Gas Deodorant for Man | Long Lasting Fragrance | No Gas Deodorant Combo Set for Man | Luxury Premium Body Spray – 120ml * 2
- PARISAR PHARMA Herbal Wax Powder for Women and Men 100g (Pack of 1) | Bikini Wax Powder with Ubtan & Sandalwood | Painless Hair Removal Powder for Underarms, Arms and Legs | for All Skin Types
- BonKaso 327 Aluminum Premium Horse Shape Push Pull Door Handle for Glass & Wooden Door – Antique Copper, Matt Finish (Set of 1, 12 Inch)
- iVOOMi Universal Mobile Stand for Desk, Adjustable Phone Stand with 360° Rotation, Foldable Metal Mobile Holder for Smartphones, Tablets, iPad & Kindle
- Portronics Apollo One 20W Wireless Bluetooth Portable Speaker with Wireless Karaoke Mic, 5 Hour Playtime, RGB LED Light, Bluetooth V5.3, Easy Grab Handle, USB/AUX in/TF Card, Type C Charging(Black)
- Livguard Inverter Battery Trolley with Covered Box | Support Single Jumbo/Flat Plate/Tall Tubular Battery |Heavy-Duty, Easy-Move Stand for Inverter and Battery – Black Red
- 13 pcs Makeup Brushes Set with 4 pcs Beauty Blender Makeup Sponges, Makeup Brush Cleaner Silicone Brush Cleaning, Eyeshadow Foundation Brush (Pack of 3)
- Cetaphil Optimal Hydration Restoring Water Gel 48 g – Lightweight 72H Weightless Hydrating Gel for Dry & Sensitive Skin | Daily Moisturisation Hydro Boost & Skin Refreshing Formula
- Safari Thorium Royale 8 Wheels 77cm Large Size Trolley Bag Hard Case Checkin Polycarbonate Luggage, TSA Lock, Wet Pouch Organized Interior, Suitcase for Travel, Trolley Bags for Travel, Vanilla Tan
- Fridge Storage Containers for Vegetables – 1200 ml (Pack of 6) | Refrigerator Organiser Boxes | Freezer Safe, BPA Free Plastic | Kitchen Storage Box for Fruits
- SkinSide Hair Scalp Massager Brush for Hair Growth | Shampoo Brush Scrubber | Scalp Exfoliator | Oil Brush | Super Soft Silicone Bristles | Prevents Dandruff & Hair Loss (Jumbo|Any Color)
- L’Oréal Paris Glycolic Gloss Shine Boosting Shampoo, 340ml
- Vim ProClean Dishwash Liquid with Mint powered by RhamnoTech™, Fresh Bloom with Every Wash, Removes Tough Grease and Odours, 1700 ml
- Butterfly Cordial Plus 2L, 3L & 5L SS Pressure Cooker Combo | Stainless Steel | Induction & Gas Stove Compatible| ISI Certified| Triple Safety System| Silver
- Story@Home Reversible Flannel Blankets for Winter Double Size 500GSM- Brown
- Medimix Ayurvedic Skinfit Bathing Soaps 125g (Pack of 5)| for Healthy & Protected, Cool & Fresh, Soft & Supple, Radiant & Glowing Body | Paraben & Sulphate Free | 100% Vegan
- amazon basics RJ45 Cat-6 Ethernet Patch Internet Cable For Personal Computer – 50 Feet (Black)
- Lifelong Multifunction Cooker/Kettle 1.5 litres (Best for Boiling Milk, Eggs, Soup and Maggi/Noodles), Silver, 1.5 liters (LLMC01), Stainless Steel, 600 Watt
- Nayasa Zenova, Bathroom Shelf Set of 5, No Drill Wall Mounted Organizer, Rust-Proof Metal Multipurpose Storage Rack with Soapcase & Toothbrush Holder, Black
- Xpert Dishwash Liquid Gel 900 ml | 2X Cleaning Power | Tough on Grease | Residue Free | Gentle on Hands | Orange Fragrance | Refill Dishwash Soap Pouch For All Utensils
- Dettol Icy Cool Bathing Soap Bar With 3x intense cooling (625gm), 125gm – Pack of 5
- Himalaya Herbals Neem and Turmeric Soap, 125gm (Pack of 4) with Value Pack Save Rs.20
- FRENCH ESSENCE Luxury Gift Set For Women – Perfume 60Ml & Deodorant 150Ml | Perfume and Deo Combo |Premium Gift for Wife & Girl Friend (Enchante)
- Dove Men+Care Antiperspirant Deodrant Stick For Men 40ml (EXTRA FRESH)
- ZEBRONICS Wireless Mouse, 2.4GHz, 3200 DPI, 3 Buttons, Comfortable & Ergonomic, USB Nano Receiver, Power-Saving Mode, Works on Most Surfaces, for Mac | Laptop | Computer (Freego, Black)
- Just Herbs Luxe Radiant Silk Skin Tint | Luxury Makeup | Ayurvedic Skin-Loving Formula | Dewy Finish | Glow Boosting & Hydrating (130 BEIGE)
- Presto! Premium Perfume Garbage Bags on Roll with Tie String | Small | 17×20 Inch | 30 Count | Black
- Sounce 10 Meter High-Speed HDMI Cable – Hdmi Arc Enabled | 64 Gbps | 4K 120Hz | 1080P 240Hz | Strong & Durable | Supports Up To 32 Audio Channels | Gold Plated | 10 Meter, Black (Pack of 1)
- 500 GSM Highly Absorbent Bath Towels Set, 100% Cotton, Soft and Plush, All Seasons Use, Extra Large, Cabana Style, Best for Pool, Beach, Spa, Gym (Grey Boat)
- boAt EnergyShroom PB300 Neo 10000mAh Power Bank with 22.5W Fast Charging, 3X Output Ports, Supports Android, iPhone, Tablets, Earbuds (Electric Blue)
- Dabur Dant Rakshak Ayurvedic Toothpaste – 700g (175g x 4) | With Goodness Of 32 Ayurvedic Herbs | Prevents & Calms Gum Pain | Kills Germs | Complete Family Toothpaste | No Added Fluorides & Parabens
- DABUR Herb’L Activated Charcoal Toothpaste 240G (120G x2, Pack of 2)|Whitening Black Gel Toothpaste|Fluoride Free|Fights Plaque & Extrinsic Stains|With Power of Mint|Cool & Refreshing Mouth Experience
- FLIPZON Multipurpose Metal, Plastic Rack Organizer for Shoe/Clothes/Books – (65.5 (L) x 32.5 (B) x 149 (H) Cms) (Need to Be Assemble – DIY) Rust-Proof – Large- 6 Shelve
- Logitech H390 Type-C Wired Headset for PC/Laptop, Stereo Headphones with Noise Cancelling Microphone, USB-C, in-Line Controls, Works with Chromebook – Graphite
- boAt Stone 350 Plus, 12W Signature Sound, Up to 8Hrs of Playtime, Type-C Charging, TWS Mode, Built-in Mic, Voice Assistant & BT v6.0, Portable Bluetooth Speaker(Titanium Black)
- Fiama Gel Bar Mega Celebration Pack 1kg (125g Pack of 8) | 8 Unique Soap Variants | Moisturised Skin with 30% Smoothing Body Serum | Bathing Soap Gift Set for Women & Men | All Skin Types
- Beardo Brotherhood Blend- GodFather, Whisky Smoke Perfume & Whiskey Smoke Bourbon Perfume for Men (20ml x 3) | Long Lasting Fragrance | Long Lasting Perfume for Men | Gift for Men | Gift for Friend
- Livon Hyaluron Shampoo for Women & Men | Hydrates Dry & Dull Hair | 2x Soft & Shiny Hair | No Parabens | 1L
- Dyazo 12 W 3 Port USB Car Charger Adapter with Smart ic Compatible for Oppo, Vivo, Redmi,iPhone, Samsung and All Other Smart Mobile Phones
- Crompton Energion HS Wood 1200mm (48 inch) High Speed 5S Energy Efficient BLDC Ceiling Fan (Dark Walnut), Pack of 1
- EMBARK Depth Wave Long Lasting Perfume for Men | 20ml Eau De Parfum | Fresh Aromatic Premium Fragrance | Ideal Gift for Men
- Lumina Waterproof LED Wall Lights for Indoor and Outdoor Decorative Wall Lamps Brighten Up Your Home with Stylish LED Wall Lighting 4-Way for Living Room, Bedroom, Staircase. Elevation.
- Himalaya Herbals Refreshing Cleansing Milk, 100ml
- SmartSlide Dish Drainer Tray for Kitchen Sink | Plastic Utensil Drying Tray with Water Drain Spout | Countertop Dish Drying Stand (12 x 17 Inch) (Black)
- TOMMY HILFIGER Automatic Analog Watch – For Men NCTH1791480,NSTH1791480W
- Bosco Analog Non Ticking Silent, Delicate Floral Print in Beige Colour, 20 CM Table Cum Decorative Round Wall Clock for Home, Living Room, Bed Room, Office and Kitchen | BWC-1210
- GynoCup Reusable Menstrual Cup for Women (White) | Large Size with Pouch | Ultra Soft, Odor & Rash Free | No Leakage | Protection for Up to 10-12 Hours | Medical-Grade Silicone | FDA Approved
- Ambrane 1.5m High Speed HDMI Cable Supports 3D, 4K, ARC & CEC Extension, Gold Plated Connectors, Compatible with HDMI-Enabled TV, Set Top Box, Blu-ray, Gaming Consoles (AHDMS-15 Black)
- Luxor Schneider, One Hybrid Roller Ball Pen – Green, 0.3 mm, 2500 mtrs writing length, Waterproof Ink, Consistent ink flow, Ideal for Professionals & Office essential
- Grey Laptop Briefcase for College Students and Professionals
- Beardo Rosemary Hair Spray with Redensyl & Rice Water | Activates Natural Hair Growth, Reduces Hair Fall & Breakage | Strengthens Roots | Non-Sticky Daily Hair Tonic for Men- 100ml
- realme NARZO 80 Lite 4G (Obsidian Black 2026, 4GB+64GB) | 6300mAh Segment’s Biggest Battery | 7.94mm Slim Design | 300% Ultra Volume | Pulse Light: 9 Colors, 5 Glow Modes | Ai Assist
- Mantra Chanting Soft Toy (25 Cm) Lord Ganesha Musical Soft Toys | Medium Size Soft Plush Toy | Baby Ganesha Toy with Info Booklet & Instruction | Best Gift for Infants, Kids, Babies
- Green Wood Wooden Kitchen Utensils Set, 7 Pieces, Natural Wood, Two-Tone Brown Finish, 30 cm Length
- Zebronics Sound Feast 45 Portable Bluetooth Speaker, 20W RMS, Up to 5h Playback, 6.6cm Driver, Deep Bass, 4 RGB Modes, BT v5.4, USB, mSD, TWS, Type-C Charging, Carry Handle (Blue)
- French Connection Stylish Analog Wall Clock for Home Hall Living Bedroom Kitchen with Maroon Dial – Size: 12 Inches – FCWC03-B
- French Connection Plastic Stylish Analog Wall Clock for Home with Dark Grey Dial – Size: 12 Inches – Fcwc07-B
- Boldfit Massage Gun for Pain Relief Full Body Deep Tissue Muscle Massager with 4 Pro Heads, 6 Speed Levels & Type-C Charging with 3000mAh Battery for Gym & Home BoldGun CompactX Mini, Black
- Lavie Sport 50 L Strolley Duffel Bag – Galactic M Small Wheel – Red – Regular Capacity
- Castrol EDGE SUV 0W-30 EDGE SUV 0W-30 High Performance Engine Oil (3500 ml, Pack of 1)
- CÜRAA Grill Neo Electric Sandwich Griller & Toaster | By Celebrity Chef Sanjyot Keer | Non-Stick, 2-Slice, 1000W | 2 Yr Warranty
- Samsung Galaxy S26 Ultra 5G (Cobalt Violet, 12GB RAM, 256GB Storage) with Built-in Privacy Display, AI Phone, Photo Assist, Creative Studio, 200MP Camera, 5000mAh Battery and Snapdragon 8 Elite Gen 5
- Portronics KeyLink C 60W Type C to C Flat Keychain Cable, Detachable Lanyard Tag, Braided Nylon Cord, Metal Alloy Shell, Phone Case Hook, 30CM Tangle-Free Fast Charging Data Sync Cable (Orange)
- Portronics Konnect X USB-A to Micro USB Fast Charging Cable With Max 3A Output,Fast Charging & Data Transfer, Nylon Braided, Aluminium Alloy Shell, 1M Length compatible with Micro usb Devices(White)
- Lifelong Electric Jade Roller With Ball Roller,T-Shape Roller & Y-Shape Roller Massage Heads|Facial Roller Kit For Face,For Anti-Wrinkles|Battery Powered (Llm729,1Year Warranty,Rose Gold)
- Portronics 60W Velin Type C to Type C Fast Charging Cable With Cable Organizer Strap & Keychain, 480Mbps Data Sync, Rapid Charging, Premium Silicone Build, Compatible With Laptops, Smartphones (Black)
- TG-113 Best Bluetooth Wireless Speaker for DJ Party, Outdoor, Bedroom with Great Sound, Super Bass, Portable, Rechargeable Supports TF/USB/Pen Drive/AUX (Multi-Color)
- Rechargeable Mini Bluetooth Karaoke Machine for Kids – Wireless Microphone, LED Lights, Bluetooth Speaker – Singing Toy for Boys & Girls – Birthday Gift for Kids (S7) (Multicolor)
- SPIN CART 3.5mm to RCA Cable, 2RCA Male to 3.5mm Male Stereo Y Splitter Audio Cable Compatible with Phones, Laptop, HDTV, Speaker, Home Theater (1.5m)
- Mantra Chanting Soft Toy (35 Cm) Baby Krishna Musical Soft Toys | Medium Size Soft Plush Toy | God Toy with Info. Booklet & Instruction | Best Gift for Infants, Kids, Babies
- Larah by Borosil 35 Pieces Red Bud Opalware Dinner Set for Family of 6
- Borosil Fluted Lavender Dinner Set, 25-Pieces, White
- Patanjali Kesh Kanti Shikakai Hair Cleanser 650 ml, Natural Conditioning Shampoo for Dry & Damaged Hair, Scalp Cleansers for Men and Women, All Hair Types
- Waterproof Shoe Cover for Women & Men | Reusable Rain Boot Cover with Anti-Slip Sole | Monsoon Footwear Protector for Bike Riding & Travel Gym Pack Of 6 (3 Pair), Pink
- 65W Charger Compatible With Nothing Original USB-C to USB-C Fast Charging Cable CMF Charger Cord for Smartphones, Compatible with Nothing Devices, Google Pixel, Samsung Galaxy, Devices (White)
- Stayfree Secure Xpert XL Sanitary Pads for Women | 290 mm | 40 Pads | Longer & Wider Pads for Heavy Flow | Air Soft Cover | Helps Prevent Skin Irritation | Fits in Pocket | Gel Lock Pockets for Instant & Deep Absorption | Dermatologically Tested
- Crompton Param 13W Round B22 LED Cool Day Light
- Amazon Basics Premium Ankle Support | Adjustable Compression for Daily Comfort | Breathable Fabric | Padded Design for Stability | Unisex | Large | 1 Unit
- Lenovo Yoga Slim 7 Smartchoice Aura Edition Intel Evo Core Ultra 5 226V (16GB RAM/512GB SSD/14 inch (35.5cm)/WUXGA OLED/Copilot+ PC/Windows 11/MSO 365 Basic+Office 24/Grey/1.19Kg), 83JX00ENIN Laptop
- Bosch 368L, 1 Star, Frost Free Double Door Refrigerator with 2.5 L Water Dispenser | 6-in-1 Convertible Storage Modes | Fresh up to 10 Days | 2 Cooling System (CTC39S21AI, Fine Steel, 2026)
- Amul Comfy Men’s Pure Cotton Mini Trunk | Soft, Breathable Fabric | Regular Fit | Assorted Colours (Colour May Vary)
- Crompton Param LED Bulb | 9W | Cool Day Light | B22 Base | 180 Degree Coverage | 4kV Surge Protection | 440V High Voltage Protection | Pack of 2
- YOHO Colored PU Fashion Sneaker for Men | Comfortable Shoes | Cushioned Insole | Quick-wear Elastic Laces | Lightweight | Dynamic Feet Support | Fashionable | Stylish | Modern
- MIKANIX Mini Cooler Fan for Room, Kitchen, Home & Office Desk | USB Cable, 3 Wind Speed Mode with Cooling Misting Fan (Black)
- Dr. Pets Pack of 5 (70g Each) Treetos Mix Flavour Dog Treats Soft Chew Sticks | Training Snacks | Easy to Digest for Puppies & Dogs
- ASUS Vivobook Go 14 (2026),AMD Ryzen 3 30 Processor,AMD Radeon iGPU,8GB RAM,512GB SSD,FHD,14″ (35.5 cm),Windows 11,M365 Basic(1Y)* Office 2024,Mixed Black,1.38 Kg,E1404FA-EB1414WS,Thin & Light Laptop
- DAHSHA Unisex Nylon RFID Travel Family Passport Holder Card Holder Wallet Travel Accessories Document Organizer, Passport Cover, with Removable Hand Strap (Black- 12.5 x 3 x 23 cm)
- Zebronics Wattz 60CC4 Type-C to Type-C Braided Cable, PD 60W, Upto 480Mbps Data Sync, 20 cm, Durable, Charge & Sync, Rapid Charging, Compact with Keychain Case, For Laptops, Tablets, Mobiles (Black)
- Zebronics USB Type-A to Type-B Printer Cable, 3 Meters, 480Mbps High-Speed Transfer, Nickel-Plated Connectors, Full Copper Core, for Printers, Scanners & Other Devices (PC30P)
- Puma Men Snatch V2 Sneaker
- Puma Men Forbes Sneaker
- ZEBRONICS Type C to Type C Strong Braided Cable, 60W PD Fast Charging, for iPhone 16 Series, 15 Series, iPad, MacBook, Samsung, Other Android Devices, Data Sync, 1 Meter (ZEB-TT60+) White
- Motorola razr 40 (Vanilla Cream, 8GB RAM, 256GB Storage) | External AMOLED Display | 6.9″ AMOLED 144Hz Display | 64MP Main Camera | Android 13
- BSB HOME 220 GSM Solid Plain Reversible Summer Microfiber AC Comforter/Duvet| All Season Single Size 3 Layered Quilted Blanket for Single Bed (220 cm x 152 cm, Candy Pink)
- Vu California 108cm (43 inches) Smartchoice Glo MiniLED Google 4K TV VUGLOMINILED 2026
- Lifelong Adjustable Pull-Up Bar For Home Gym | Best For Kids, Men & Women | Non-Slip Pull-up Bar (Multicolor)
- Lumio Vision 7 II 2026 139 cm (55 inches) 4K Ultra-HD Smart QLED Google TV FTW3-ADSK
- Butterfly Hero Mixer Grinder, 500W, 3 Jars (Grey) & Cordial Induction Base Aluminium Pressure Cooker with Outer Lid, 3 Litres, Silver
- Butterfly Hero 500W Mixer Grinde With Jar And Vegetable Chopper
- Butterfly Hero 500 Watts Mixer Grinder with 3 Jars
- Tommy Hilfiger Multifunction Blue Dial Brown LeatherStrap Automatic Analog Watch – For Men TH1710633,NTTH1710633
- One94Store Mini Star Fairy String Lights – 14 LED, 3 Meter, Warm White Decorative LED Lights for Bedroom, Home, Garden, Diwali, Christmas, Wedding & Party Decoration (Pack of 1)
- Himalaya Herbals Nourishing Skin Cream, 50ml
- BOXJOY Plastic Kids Wardrobe with 6 Doors, Sticker Sheet & 5 Hook Holder
- Bergner Bellini Plus Non Stick Casserole/Biryani Pot/Handi with Glass Lid 32cm, 9 Litre, Induction Base, Red, Gas Ready
Offers
- Flipkart Big Billion Days 2026: BBD Sale Date and Offers
- Amazon Great Indian Festival Sale 2026 : Deals Discount + Banks & Card Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Who was the top scorer for India in the T20 World Cup final 2024?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 31st October 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 31st October 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 31st October 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbabydodiedobajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdecathlondistrictdmartDomino'sdroomeazydinerelementsepicgamesfastandupfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsyskyscannersnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato