Pages
- Best Laptops Deals July 2026
- Best Smart Watches July 2026
- Mobiles
- Amazon Deals & Offers for July 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 19th July 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Symbol Men Festive Long Regular Fit Kurta & Pyjama Set (2Pcs)
- Symbol Women’s Cotton Stretch Non Padded Wire Free Full Coverage Lift Up Bra
- CELLO Urban Bite Lunch Box with Bag for Office Use, White Brown | 3 x 400ml Stainless Steel Containers, 800ml Water Bottle with Fork & Spoon, Leak Proof Airtight Clip Steel Tiffin Box Set for Travel
- Haier 598 L 3 Star Frost Free Expert Inverter Smart Sense AI enabled 3-Door Side by Side Refrigerator (HRT-683ISU1, Inox Steel, Magic Convertible Zone, Deo Fresh Technology, 2026 Model)
- LG 251 L, 1 Star, Frost-Free Smart Inverter Double Door Refrigerator with Smart Mode (GLT2516WWPZ, Shiny Steel, Multi Air Flow Cooling with Max Fresh Zone, 2026 Model)
- Symbol Girl’s Cotton Ribbed Stretchable Leggings | Ankle Length | Aged 2-14 Years
- Symbol Women Rayon Fit and Flare One Piece Midi Length Dress (Available in Plus Sizes)
- WADERS Automatic Changeover For Generator, Solar Plant & Inverter Supply With Current Limiter ACCL (EB:25 Amps Gen:25 Amps)
- RR Signature Jaipur Gangaur BLDC 5 Star, 28-watt & 60% Energy Savings, Designer High Speed Ceiling Fan With Remote, for Home & Office Champagne Gold
- Portronics Harmonics Twins S3 Smart TWS Bluetooth 5.2 Earbuds with 20 Hrs Playtime, 8mm Drivers, Lightweight Design(Black)
- Asian Paints TruCare 12-in-1 Pcs Combination Jaw Spanners Wrench Set | Carbon Steel with Rust & Corrosion Resistant Chrome Plating & Satin Finish | Multipurpose Combination Tool Kit | IS: 2028:2004
- LUX VENUS Vest for Men White | 100% Cotton | Pack of 5
- Murphy Crest Premium 7W 3-in-1 LED Concealed Down Light |Cool White, Warm White & Natural White | Switch Controlled Color Changing | Modern False Ceiling Lighting | 2-Year Warranty | Pack of 2
- Anchor by Panasonic Penta Modular Polycarbonate 12m Horizontal Plate with Chrome Collar (White)
- Streax Serum Shine Hair Mask for Frizzy Hair-200gm, Mask for Dry, Damaged Hair, Provides Deep Conditioning & Nourishment, Infused with Shea Butter, For Dry, Frizzy Hair, For All Hair Types
- Bagsy Malone Half Moon Sling Bag | Modish Sling Bag (Croco Grey1)
- Funblast Plastic Magnetic Pencil Box With Sharpener Space Explorer Themed Luxury Pencil Case For Kids Stationery Organizer Pencil Box For Boys, Kids, Girls (Dinosaur) Multicolour
- Jabra Evolve 10, On Ear Noise Cancellation Mic with Fully Adjustable Boom Arm and USB-A Connectivity Stereo Headset, Black
- Bagsy Malone Tote Bag -Set of 2 | Handcrafted Side Tote Bag and Handbag for Office and College (Croco White)
- Maybelline New York Sunkisser Highlighter + Blush, 01 Downtown Rush | 4.7 g
- BELLAVITA NIGHT FEVER perfume for Men & Women|Citrusy & Fruity Notes|Long Lasting Scent| Eau de Parfum – 100 ml (For Men & Women)
- Neelam Stainless Steel 11 (22G) Lazer Etching Deep Dabba, 1400 ml, Silver – Durable & Elegant Storage Container with Flower Printed, Ideal for Storing Food, Perfect for Daily Uses
- Haier 7 Kg AI One Touch, AI Smart Wash (AI-DBT), PuriSteam, 525mm Super Drum, In-Built Heater,WI-FI, Fully Automatic Front Load Washing Machine, (EFL70-IM12F3BKU1 | Black)
- Cureveda Liposomal Vitamin D3 600 IU + Vitamin K2-7 & Turmeric | High Absorption Bone & Heart Support | Promotes Muscle Health & Immunity | 120 Tablets (120 Day Pack)
- Puma Unisex Adult Leadcat 2.0 Slide
- Husk, 1kg (Sat-Isabgol) | Nutfino Psyllium Husk, 1kg (Sat-Isabgol)100% Natural Soluble Fiber Supplement Supports Gut Health & Regular Bowel Movements
- Husk, 1kg (Sat-Isabgol) | Nutfino Psyllium Husk, 1kg (Sat-Isabgol)
- Wonderchef Nutri-blend Activ Mixer Grinder Blender, Smoothie Maker, 500W 22000 RPM 100% Full Copper Motor, 2 Unbreakable Jars, SS Blades, 2 Year Warranty, Recipe book by Chef Sanjeev Kapoor, Red
- Spigen USB Type C Cable 3 A 1.5 m PVC PB2301 (Compatible with Mobile, Black, One Cable, USB Type A To USB Type C)
- Whirlpool 9 Kg Steam Wash Technology 5 Star Inverter Front Load Fully Automatic Washing Machine with In-Built Heater (SUPREME CARE 9014-E, Midnight Grey, 100+ Tough Stains, 1400 RPM)
- REEBOK Cool Your Body | Premium Long Lasting EDT Perfume for Men 100ml Eau de Toilette – 100 ml (For Men)
- Polycab Wizzy Plus 1200mm 5-Star BLDC, Remote Ceiling fan for Living Room| 55% Energy Saving, 100% Copper, High Air Delivery | 3+1 yr Warranty【Matt White Black】
- Panasonic 15W LED Round Downlight for Ceiling | Twist & Fit Round LED Modular Surface Ceiling Light for Home & Hall (Cool White,PDLM22157-2)
- Lexton Cork Light | Bottle Light | Blue Copper String Light | Cork String Light | 4 Pieces | for Valentine’s Day, Room décor, Birthdays, Party,Diwali
- Dabur Herb’l Neem Germ Protection Toothpaste Toothpaste (199 g)
- Campus Men Og-30 Sneakers
- CELLO H2O Water Bottles Set of 3 Pcs For Daily Use, 1000ml Each Multicolor | Stylish & Unbreakable BPA-Free Leakproof Refrigerator Safe Pet Water Bottle For School, Office, Kitchen & Travel
- Casio MTP-VT01L-1B Men’s Minimalistic Black Dial Black Leather Band Analog Watch
- Lavie Sport Leaflet 36L Teal Backpack | Fits Upto 15 Inch Laptop | Organizer & Bottle Holder |Rain Cover |Pencil Pouch | Gift for Men, Women, Boys, Girls | Laptop Sleeve for School & College
- WAHL Rapid Air 2200 Watts Super Dry Hair Dryer with Overheat Protection and Cool Shot|Powerful Drying with Less Heat |Hair Dryer For Men and Women | Gifting | Foldable – Travel Friendly
- Gillette Fusion 5, Shaving Razor For Men | With Beard Shaping Back Blade | 5 Blades For Your Perfect Shave | Styling Back Blade For Your Perfect Beard Shape
- Vector X OMCS-343 Men Printed Compression Multi-Purpose Shorts (Training,Innerwear,Athletic,Swimming,Skating,Cycling,Fitness)
- Lavie Women’s Pyth Keg Textured Sling Bag | Ladies Purse Handbag | Textured, Ladies, Purse
- BELLAVITA Skai Aquatic EDC & Fresh EDT | Long Lasting 2x20ml Perfume for Man & Woman | Gifts for Woman | Bergamot, Ylang Ylang, Pink Pepper | Premium Fragrance
- Havells REO BLDC 1200MM 5 Star Rated Ceiling Fan| Air Flow: 220 CMM| Speed: 350 RPM|Watt: 33W| Reverse Rotation Mode| Timer Setting| 2 Year Door Step Warranty By Manufacturer (Unnovate, Stone Grey)
- Wonderchef Valencia Plus Non-Stick Cookware 3 Piece Set | Kadhai, Glass Lid, Dosa Tawa | Cool Touch Bakelite Handles | Pure Grade Aluminium| PFOA Free| 1 Year Warranty | Purple
- CELLO Aluminium Nonstick 12 Cavity Appam Patra Pan Maker with Steel Lid, Black | 2 Side Riveted Handle, Gas Stove Compatible Die-Cast Mini Uttappa Paniyarakkal Cup Cake Frying Pan Kadhai for Kitchen
- CELLO Double Treat Set of 3 Pcs Lunch Box for Office Use with Jacket Blue | 2 x 300ml Stainless Steel Containers, 1 x Oval Container |Lightweight Leakproof Airtight Tiffin Box Case For School & Travel
- Pampers Premium Care Pant Diapers – New Born (70 Pieces)
- CHANDRIKA With Glycerine Ayurveda Gel Bathing Bar Soap,| Jojoba Oil for Moisturized Skin (6 x 125 g)
- DENVER Magnus Perfume|Premium & Long Lasting| Eau de Parfum – 100 ml (For Men)
- Aristocrat Enigma 52 Cm Polyester Softsided Cabin Size Duffle Bag – Red
- Angel Kids 2 in 1 Xylophone and Mini Piano for Kids Educational Musical Instruments Toy (Multicolor)
- BOROSIL Teal Bag, 3 Pc (320 ml x 2 + 240ml x 1 ), Office Tiifin 3 Containers Glass Office Lunch Box (880 ml)
- Lux Inferno Ladies Round Neck Thermal Vest | Half Sleeve | Regular Fit |
- Maharaja Whiteline Speedmix Plus Hand Blender with Stainless Steel Blades | Long Lasting Performance with 175 Watts Motor | Detachable Plastic Foot | 2 Year warranty (Turquoise Blue & White)
- Logitech F310 Gamepad – Blue
- DELL Alienware 16 Aurora (i7 14th Gen) Microsoft Office Home 2024 Intel Core 7 240H – (16 GB/1 TB SSD/Windows 11 Home/8 GB Graphics/NVIDIA GeForce RTX 5050) Alienware 16 Aurora AC 16250 Gaming Laptop (16 $Inch, Interstellar Indigo, 2.57 Kg, With MS Office)
- CELLO Tiffy Hotwheelz Gift Set Insulated Lunch Box & Water Bottle for Kids | Tiffin Box 460 ml, Water Bottle 400 ml, Blue & Orange | Leak Proof | Easy to Clean | Ideal for School, Picnic
- Haier 9 Kg Oceanus Wave Drum 15 Min Quick Wash Fully Automatic Top Load Washing Machine, Dark Jade Silver (ETL90-C8S8)
- VIP Snooze Travel Neck Pillow | Premium Soft Memory Foam Neck Pillow for Men & Women | Comfortable Cushion | Perfect for Travel & Casual Use (Grey)
- NK BRSLA DRAWSTRNG – 9.5 (18L)
- Logitech G502 X Lightspeed Wireless Gaming Mouse – Optical Mouse with LIGHTFORCE Hybrid Optical-Mechanical switches, Hero 25K Gaming Sensor, Compatible with PC/macOS/Windows – Black
- Giordano Analog Watch for Men with Round Dial, Roman Numeric Indices and Stainless Steel Strap – GZ-50112
- Parachute SkinPure Hyaluron Body Lotion with Virgin Coconut Oil | Deep Hydration for All Skin Types | Moisturises for up to 72 Hours* | Clean, Nourishing Formula | 400 ml
- Mamaearth Hydra-Glow CC Serum with Vitamin C & Hyaluronic Acid – Peach – 30 ml | Hydrates Skin | Natural Coverage| SPF 30
- Parachute Advansed Protein Shampoo | with Coconut Milk and Aloe Vera | For up to 100% Damage Repair & up to 3X Softer Hair | Protein Lock Technology | Paraben-Free | For Men & Women | 1L
- TCL 55Q6CS 139 cm (55 inch) Ultra HD (4K) Mini LED Smart Google TV with High HDR Brightness | 312+ Dimming Zones | AiPQ Processor | Dolby Vision-Atmos 40 W ONKYO 2.1 Hi-Fi System | IMAX Enhanced (55Q6CS)
- XIAOMI F Series 108 cm (43 inch) Ultra HD (4K) LED Smart Fire TV with Dolby Audio | Box Speakers | Alexa | 32GB Storage | Filmmaker Mode| Mi TV (L43MB-FIN)
- THE MAN COMPANY Black perfume Eau de Toilette – 50 ml (For Men)
- Indulekha Bringha Shampoo|| Proprietary Ayurvedic Medicine for Hairfall|| 580ml
- Parachute Advansed Baby | Face & Body Baby Wipes | With Virgin Coconut Oil & 99% Pure Water | Hypoallergenic, Dermatologically Tested & pH Balanced | Moisture-lock Lid | 72 wipes * Pack of 3
- KINGSWAY Car Window Curtain Sticky Sun Shades Compatible with Honda Civic, (Year 2006-2015), Universal Fit Sunshades for Side Window, Rear Window, Blue Color, 4 Pieces
- Stewit® Premium Toothbrush Container Toothbrush Cap, Caps, Cover, Covers, Case, Holder, Cases, Travel, Home use Kitchen Tools (Pack of 4)
- Nike Unisex Nk Air Grx Bkpk Backpack
- Green Soul Shangri-La| Single Seater Electric Recliner Sofa with Oversized Backrest, Premium Comfort and Soft Suede Fabric | Motorized Recliner |3 Years Warranty (Beige) with Installation
- Nilkamal Gem Plastic Cabinet With Mirror, 12.5D x 44.6W x 55.3H cm (Black)
- Nilkamal SpaceMax 2 Shelves Plastic Bookshelf with 3-Year Warranty| Multipurpose Storage Cabinet & Book Rack for Home | Durable, Waterproof, Easy-Clean | Living Room & Bedroom Organiser|Charcoal Grey
- CELLO MF Trent Plus Lunch Box with Bag for Office, Blue | 300ml x 2 Steel Containers, 500ml Oval Plastic Containers, Leak Proof Airtight Snap Lock Lid Tiffin Box Set for School Kids, College & Travel
- Cello Frosty Delux Bathroom Set (18 L Bucket & 1 L Mug), Blue | Lightweight Durable & Sturdy with Easy-Grip Handles | Plastic Multipurpose Bath Set for Modern Bathrooms
- Karachi Bakery Karachi Halwa 500 g
- Cello Imperial Red Rose Fantasy Opalware Dinner Set, 19 Pieces, White
- Amazon Pay Gift Card – Red Envelope For Wedding
- Karachi Bakery Pineapple Flavour Cookies 400gm | Tea Time Snack | Delicous Snack | Vegetarian
- PROWL by Tiger Shroff Buy 1 Get 1 Free
- Crompton Laser Ray Smile 24W LED Batten (Warm White) – Pack of 2
- ORION Choco Pie – Chocolate Coated Soft Biscuit 12 Pcs Pack, 336 g
- Bagrry’s Whey Protein Muesli 750g | 20g+ Protein | Chocolate Flavour | Whole Oats, Whey Protein, Californian Almonds & Bran | Breakfast Cereal | High Protein & Fibre | Premium American Whey Muesli
- CELLO Glassy Mix Lunch Box with Jacket for Office, Transparent | 2 x 320ml, 1 x 240ml Glass Containers, Microwave Safe Leadfree Toughened Glass, Airtight Leakproof Tiffin Box for Daily Use & Travel
- CG-Azuma 15Ltr Storage Water Heater (Geyser) 5-star | 100% Copper Element | Hirise Suitable | Glasslined Tank | IPX4 Rated | Anti Corrisive Rod | Free Installation | 2 Yrs Product 7 Yrs Tank Warranty
- Cello Chiller Ice Box | Standard Size for Travel Party Bar Ice Cubes | Cold Drinks | Medical Purpose | 3 Litre, Red
- CELLO Fit & Fresh Rectangle Lunch Box Container for Daily Use 370 ml, Clear | Microwave & Fridge Safe Toughened Glass Airtight Food Storage Tiffin Box Container for Kitchen, Travel & Office Use
- CELLO Brilliant Hi-Ball Glass Set of 6 Pcs 275ml, Transparent | Freezer & Fridge Safe, Leadfree Dishwasher Safe Toughened Crystal Clear Glasses Set For Drinking Water Juice Milk Cocktail Mocktail Soda
- ARCHIES Rakhi Collection for Rakshabandhan | Rakhi for Brother | Rakhi for Bhaiya and Bhabhi | Rakhi Combo Gift Hamper (OM Design Rakhi)
- Nilkamal Alexis Solid Wood Center Table (Red Walnut)
- SUPERSTUD Scalp Massager For Hair Growth || Rechargeable Electric Head Massager with 3 Speed Modes | Head Scratcher for Stress Relief, Relaxation & Deep Clean
- CELLO Moonstone Solitaire Series Opalware Dinner Set of 18 Pieces For Family of 6 | Bone-Ash Free & Leadfree Opal Glass Microwave & Dishwasher Safe, Crockery Plates & Bowls Set For Daily Use & Gifting
- Manna Black Dates 400g – Khajoor Khajur Natural. Rich In Iron, Fibre & Vitamins. Premium Imported, Fresh
- Fiama Skin Barrier Strengthening Moisturizing Soap Bar 125gx3, Blueberry & Japanese Hokkaido Milk Celebration Pack of 3, Non-Sticky Soft Skin, 1/3rd Moisturizers, For Men & Women
- Dixcy Scott Cross Trunk | Long Leg Trunks for Men | 100% Combed Cotton | Soft, Sweat-Absorbent Waistband | C-Open Front Men’s Underwear | Self-Hem Leg Grip Innerwear for Man | Pack of 5
- Jaspo Power Kids 26″ inches Skateboard for Beginners Boys & Girls (6 Years & Above, Skate-Board, Vinyl, Black)
- LuvLap Baby Wash – 600ml, with Milk Protein, Oatmeal, Shea Butter and Vitamin E, Soap Free, Baby Wash for Baby Bath, Natural, pH Balanced & Paraben Free, Dermatologically Tested
- Wild Stone CODE Travel Pack with Iridium, Titanium, Steel and Copper Perfume Body Spray for Men, Pack of 4 (40ml each)|Gift Set for Men
- CRAE SF-400 Digital Kitchen Weighing Scale | 10Kg x 1g Precision | 1 year (6+6 months) warranty | Food Scale with LCD Display for Cooking, Baking, Meal Prep & Healthy Diet | (White)
- Aristocrat Airpro Set of 2 Cabin (Small Size) & Medium Size (Check-in) Hard Case Trolley Bags, 8 Wheels, Polypropylene Case Luggage, Combination Lock, Unisex, 3-Yr Global Warranty, Poseidon Blue
- Al-Nuaim E-Series Zoop Alcohol Free Attar – 6 ml
- Funskool – Play & Learn Funskool Play & Learn-Seasons,Educational,120 Pieces,Puzzle,for 4 Year Old Kids and Above,Toy
- Acer Smartchoice Aspire One, AMD Ryzen 5-40, 8GB LPDDR5 RAM/ 256GB SSD, 14.0″/35.56cm WXGA Display, Win 11 Home, Pure Silver, 1.48KG, A114-43, Thin and Light Laptop
- Signoraware Perfecto 4 Coating Non Stick Kadhai 28cm | Gas & Induction Compatible | Low-Oil Cooking | Ergonomically Designed | Ideal for Frying, Sauteing or Preparing Rich Curries (4.5 LTR | Steel)
- NFI essentials Microfiber Super Absorbent Bath Towel (57″x30″) Soft Bath Towel for Multipurpose Use for Sports, Travel, Fitness, Yoga, Bathroom, Gym (TOW-3-P1 & P3 (Pack of 2))
- Lifelong Wireless LLGM36 Powerful Gun Massager with 4 Heads|Deep Tissue Percussion Muscle Massager for Pain Relief & Recovery|Portable Handheld Electric Fascial Gun Massager (1 Year Warranty, Black)
- Dorall Collection Scarlet Rouge Eau De Toilette for Women, 100 ml
- Symbol Men’s Solid Cotton Slim Fit Formal Shirt | Plain | Full Sleeve
- Nautica Round 42mm Gray Dial Analog Men Watch – NAPMYF302
- Crasts Pressure Spray Pump | Gardening Water Pump Sprayer | Plant Water Sprayer for Home Garden | Spray Bottles for Garden Plants and Lawn | Plant Watering Can (Spray Pump 2 Liter) (Red)
- Decor EcoLite Bamboo Non Toxic Eco-Friendly Reusable 4 Small Plates and 4 Bowls Dinner Set for Couples (Natural White) – 8 Pieces
- 12mm X 65 meter Pack of 6 Brown BOPP Packing Cello Tape with Durable Materials Self Adhesive Heavy Duty Tep Roll Ideal for Packaging Box 1/2 inch 65mtr
- ACTIVA Apsara 900mm Ceiling Fan, 650 RPM High Speed Air Delivery, Aerodynamic Wide Tipped Blade for Air Delivery in Every CornerAnti Dust Coating, 60 Watt Motor, 2 Years Warranty – White
- Crompton Fabrimagic Neo 1440 W Steam Iron with 200 ml water tank, Upto 15g /min Steam Output with Vertical Steaming and Non-Stick Soleplate (Blue), 6 Fabric Settings (ACGSI-FABRIMNEO144)
- KEXIN SSD 128GB SATA III 2.5-Inch Internal Solid State Drive up to 450MB/s 3D NAND Flash for Laptop PC Storage and Upgrade – Black
- Tata Tea Gold All-in-1 Instant Premix Cardamom Tea, 14g Per Serve, Quick & Easy To Make Cardamom Tea, 10 Sachets
- Kwality Custard Powder 1kg (Vanilla Flavor), Smooth & Creamy Custard, Quality Ingredients, Best for Fruit Salads
- Britannia Little Hearts, 75g
- TAZLYN waffle maker machine 3 in 1 home kitchen appliances for home kitchen items gift Non-Stick Surfaces,4 Inch, Perfect for sandwich maker electric, Pan Cakes, Paninis/Other Snacks- 350 Watts
- Halonix 20 Watts Astron Plus B22 Led Bulb (White)
- JASIFS Alarm Clock Digital Plastic Clock Table Clock for Students Watch for Study Home Office, Bedroom Kitchen Desk Alarm Clocks with Automatic Sensor Time, Date & Temperature (White Clock), 14*8 Cm
- Wembley Educational Laptop for Kids Toys for 2-5 Years Learning Activity Computer Educational Toy for 3 Years Old Boy Learn Alphabet,Letter,Words,Games,Mathematics,Music,Logic Memory Tool,Multicolour
- Famous Quality Folding Materials and Smooth Surface Magnetic Chess Board for Kids and Adult, 10.2-Inch
- Logitech G333 Gaming Earphones with Gaming-Grade Dual Drivers with USB-C Adapter & in-line Mic and Volume Control with 3.5mm aux – Black
- Brono Orange Shine Expert Floor Cleaner Detergent Powder (multi) (5 kg)
- Parachute Advansed Almond enriched Coconut Hair Oil with Vitamin E 300ml|Nourishes & Softens Hair | Helps Control Hair Fall| Helps Promotes Hair Growth | Up to 2x Softer Hair|Non-Sticky Formula| Dermatologically-Tested Hair Oil | For Men & Women
- Logitech G PRO X Superlight 2 Lightspeed Wireless Gaming Mouse, Lightweight, LIGHTFORCE Hybrid Switches, Hero 2 Sensor, 32,000 DPI, 5 Programmable Buttons, USB-C Charging, PC & Mac – White
- Layer’r Wottagirl Pure Paradise Body Mist for Women 135ml Pack of 2 | Long-lasting fresh floral fragrance with grapefruit, apple, jasmine, guaiac wood & amber notes.
- Fiama Body Wash Shower Gel Blackcurrant & Bearberry 250ml | Fiama Body Wash Shower Gel Peach & Avocado 250ml | Fiama Body Wash Shower Gel Lemongrass & Jojoba 250ml, Body Wash for Women and Men, Combo Pack of 3 for Moisturized Skin
- Logitech G PRO Mechanical Gaming Keyboard, Ultra Portable Tenkeyless Design, Detachable Micro USB Cable, 16.8 Million Color LIGHTSYNC RGB Backlit Keys,Black
- Logitech G F310 Wired Gamepad, Controller Console Like Layout, 4 Switch D-Pad, 1.8-Meter Cord, PC/Steam/Windows/AndroidTV – Grey/Blue
- Logitech M186 Wireless Mouse, 2.4GHz with USB Mini Receiver, 3 Years Battery Life, 1000 DPI Optical Tracking, Ambidextrous, Compatible with PC, Mac, Laptop
- Streax Permanent Hair Colour, 100% Grey coverage, Infused with Argan and Walnut Oil, Long Lasting Cream Hair Colour for Women, Blonde hair Colour, 7.3 Golden Blonde, 120 ml, Pack of 1
- Symbol Women Cotton Stretch Padded Wire Free Medium Coverage T-Shirt Bra
- TRIGGR Kraken X5 with 50H Battery, BT v6.0, 40 ms Low Latency, 4-Mic ENC, Rapid Pairing Bluetooth Headset (Cyber Black, True Wireless)
- TRIGGR Trinity Neo with 80H Playtime, Dual Pairing, ENC, Fast Charging, Bluetooth v6.0 Bluetooth Headset (Cosmic Black, On the Ear)
- Goboult Tenet Pro with ANC, 75H Playtime, 4 Mic ENC, Dual Pairing ,BT 6.0, 13mm Drivers Bluetooth Headset (Crimson Red, True Wireless)
- Get Fresh Dry fruits Afghani Anjeer-Dried Figs 1 kg || Figs (1 x 1000 g)
- CARESMITH Charge Go Massage Gun | Massager Machine for Pain Relief | Massage Gun for Back Leg & Full Body | 4 Specialized Heads For Full Body Pain Relief
- Haier 240 L 2 Star Frost Free Twin Inverter Double Door Refrigerator with Cool Pad for Extended Freezer Cooling & Spacious Fresh Zone (HEF-252EGSA-P, Moon Silver, 2026 Model)
- Haier 325 L 3 Star Frost Free Triple Inverter Double Door Bottom Mount Refrigerator, Digital Touch Display & 2X Bigger Fresh Storage (HEB-333DSA-P, Dazzle Steel, 14 In 1 Convertible Modes, 2026 Model)
- 3 Wheel Kids Road Runner Scooter with Adjustable Height, Foldable Kick Scooter for 3+ Years | Skating Scooter Outdoor Toy for Boys & Girls, Birthday Gift | 50kg Capacity(Purple)
- Shimmer Dishwash Gel – 5L Family Pack | Non-Toxic & Eco-Friendly | Tough on Grease, Gentle on Skin | High Foam Formula | Removes Oil & Stains Easily | Fresh Lemon Fragrance
- EVELANCE Caring Baby Wet Wipes with lid & Aloe Vera Extract| 72 Pieces|Pack Of 12 (864 Wipes)
- DesiDiya® 35 Feet Long LED Power Pixel Serial String Light, 360 Degree Light in Bulb | Copper Led Pixel String Light for Home Decoration,Diwali,Christmas(Warm White) Pack of 1
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 19th July 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 19th July 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 19th July 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato