Pages
- Best Laptops Deals June 2026
- Best Smart Watches June 2026
- Mobiles
- Amazon Deals & Offers for June 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 28th June 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Gear LOGI-Q 27L Medium Water Resistant 5 Compartment Laptop Backpack/Backpack/Office Bag with Trolley Sleeve for Men/Women (Navy-Red)
- GLAMVEDA Rice & Ceramide And Glycolic & Salicylic Anti Acne Peel Off Face Mask (200 ml) | For Oily & Acne Prone Skin | Oil balancing, Deep Cleansing | Blackhead & Pore care
- Bru Instant | Aromatic Coffee From South Indian Plantations | Premium Blend of Robusta & Arabica Beans For a Rich Coffee Experience | 40g
- GEONIX Wired Computer Keyboard – Basic Black Keyboard – with 1.5 Metre USB-A Cable, 104-keys, Foldable Stands – Compatible for Windows, PC, Laptop – 1 Yr Mfg Warranty
- CELLO Brilliant Whiskey Rocks Glass Set of 6 Pcs, 215 ml Transparent | Leadfree Freezer & Dishwasher Safe, Toughened Glass Set for Bar, Liquor, Whiskey, Cocktail, Mocktail, Mojito & Cold Beverages
- CELLO Qube Fresh Glass Storage Jar for Kitchen 1200 ml Transparent | Durable Fridge Safe Airtight Leadfree Toughened Glass Kitchen Storage Container Jars Set For Beans, Whole Grains Spices Dry Fruits
- CELLO Modustack Glassy Storage Jars For Kitchen 500 ml Maroon | Freezer & Fridge Safe Airtight Stackable Leadfree Toughened Glass Kitchen Storage Container For Beans, Whole Grains, Spices & Dry Fruits
- CELLO Ornella Round Glass Mixing Bowls for Kitchen Set of 2 Pcs, 500 ml Transparent | Freezer & Fridge Safe, Microwave Oven & Dishwasher Safe Toughened Crystal Glass Bowls for Serving Mixing Dining
- CELLO Athlete Water Bottles Set of 4 Pcs For Daily Use, 800 ml Each Multicolor | Stylish & Unbreakable BPA-Free Leakproof Freezer & Fridge Safe Flip Top Lid Water Bottle For School, Office & Travel
- CELLO Estonia Glass Tumbler Set 310 ml Set of 6 | Versatile Clear Glasses for Mocktails Juice and Soft Drinks
- CELLO H2O Round Unbreakable Plastic Water Bottle Premium Edition | Leak proof & break-proof | Best Usage for Office/School/College/Gym/Picnic/Home/Fridge | 1 Liter | Blue, Set of 1
- Hair & Care Almond, Vitamin E & B5 Non-Sticky Hair Oil – 500ml | Up to 90% Less Hair Fall | Frizz Control | Smooth & Glossy Hair
- Fiama Skin Barrier Strengthening Moisturizing Soap Bar 125gx5, Japanese Hokkaido Milk Celebration Pack of 5, Non-Sticky Soft Skin | 1/3rd Moisturizers | Blueberry, Goji Berry & Acai Berry Combo pack
- Crompton LED30DFCDLPro-2 Base B22 30-Watt LED Bulb Combo (Pack of 1, Cool Day Light)
- Halonix Jumbo 30W LED Bulb | Cool Day Light (6500K) |Pack of 1 |Energy Efficient| 4kv Surge Protection |Base- B22 | High Wattage Led Bulb|
- Mamaearth Ubtan Sunscreen For All Skin Types Body Lotion Spf 30 With Turmeric & Saffron For Glowing Skin ? 300 Ml (Pack Of 2)
- CELLO Inspire Large Sipper Water Bottle, 900ml Black | Food Grade, Leakproof, Easy to Carry | Gym Straw Water Bottle For Fitness, Office, School, Sports, Picnic, Travel & Outdoor Hydration
- JO Lime Fresh Soap (Pack of 8), 150 gram
- Himalaya Lip Balm 10gm| Soft| Naturally Pink Lips| Made with 100% Herbal Actives
- Roxila® Pure Silicone Treadmill Lubricant Oil 1 Litre | High Viscosity Belt Lubricant with Easy Dispenser | Reduces Noise & Friction | Extends Motor & Belt Life | Compatible with All Treadmills
- Mivi Nex 100 Sound Bar for Smart TV | 90W 2.1 Channel Home Theatre Speaker with Subwoofer | Bluetooth v5.3 | Deep Bass | Music System for Wireless | Speaker Home Theatre | Made in India
- Hydrating Shampoo 300 ML for Dry, Frizzy & Dehydrated Hair, Anti-Dryness Shampoo, Hydrates and Moisturizes Bouncy Hair Full of Life Enriched with Aloe & Cruelty- Sulfate- Paraben Free
- wipro Garnet N70002 B22 7-Watt LED Bulb (Warm White/Golden Yellow) -Pack of 2
- GEONIX Vigor R7 Wired Gaming Mouse with 1200 DPI, PVC Cable, 3 Buttons, Center Click, 1 Year Warranty (Black Red)
- Vivel Cool Mint, Soft Fresh Skin Soap, 600g (150g – Pack of 4), Soap for Women & Men for Soft, Glowing & Moisurised Skin, All Skin Types
- HP 410 Slim White Bluetooth Mouse/Bluetooth 5 connection/12 Month Battery life/1000-2000 dpi Multi-Surface Sensor/Compact and Ambidextrous Design
- Panasonic 9 Watt LED Concealed Downlighter, LED Recessed Downlight, 85mm Cut Out, BIS & ROHS Certified, 4KV Surge Protection, Warm White Light (PDLM34093)
- HomeWiz Plastic Oil Dispenser 500 ML Cooking Oil Dispenser Bottle Oil Container | Slide Top | Kitchen accessories items for home | Oil Dispenser 500 ML steel | Oil bottle for Kitchen
- Set Wet Cool, Charm & Swag Avatar Deodorant & Body Spray Perfume For Men,Pack of 3,180 ml Each
- Bru Instant | Aromatic Coffee From South Indian Plantations | Premium Blend of Robusta & Arabica Beans For a Rich Coffee Experience | 200g
- Tata Tea Premium Care Black Tea 1kg, Delicious Tea with Goodness of Tulsi, Mulethi, Ginger, Brahmi & Elaichi, Trusted Quality Tea, Loose Leaves
- Tata Tea Gold Care 500 gram, Goodness Of Cardamom, Ginger Powder, Tulsi, Brahmi & Mulethi, Natural Ingredients, Exquisite Blend Of Tea, Rich In Taste, Black Tea
- Tata Tea Chakra Gold Premium Leaf, Rich Aroma & Taste, Black Tea With Leaf, 250 gram
- Saffola Masala Oats | 225g | Classic Masala | Tasty, Anytime Snack | Ready in 3 mins | Millets Goodness- with Bajra & Jowar | No maida, No added preservatives | Helps manage weight
- Halonix 14W LED Light Bulb | White (6500K) |Energy Efficient| 4kv Surge Protection | High Lumens Per Watt | Pack of 1
- Himalaya Baby Diaper Rash Cream (20g) | Relieves Rashes, reduces Redness & Irritation | With Aloe Vera, Yashad Bhasma, Almond Oil
- Tata Tea Gold All-in-1 Instant Premix Masala Tea, 14g Per Serve, Quick & Easy To Make Masala Chai, 10 Sachets
- Boat Type C to Lighting Cable for 27W Fast Charging | 480 Mbps Data Transfer | 1.2 m (3.9 ft) Perfect Cable Length | Premium Nylon Braiding | Durable & Tangle-Free | with Silicon Tie (Arctic White)
- WildHorn Genuine Leather Wallet for Men | Slim Bifold Wallet with RFID Blocking | Multiple Card Slots & Coin Pocket | Premium Leather Mens Wallet
- ToyMagic Dancing Monkey|Voice & Touch Sensor with Musical Light & Sound Effect|AAA Battery Operated|Birthday Gift|Spinning & Rolling Doll Tumble Toy for Kids 1 Year +|Made in Indiaorange
- Jam & Honey Outer Space Solar Sytem Jigsaw Puzzle | Zero Gaps | Learning Aid | Educational Toy | for Boys & Girls | Suited for Ages 5 Years and Above | 61 Pieces
- Colgate Sensitive Everyday Protection Toothpaste, For Sensitivity Relief, 480g (Pack of 3 x 160g)
- Bajaj 20W Cool Day Light LED Tubelight (Pack Of 1) | LED Tube Light For Home | IR Free | UV Free | Voltage Surge Protection Of 4 KV | Bright & Energy Efficient | White | 1 Year Warranty
- Livon Hyaluron Shampoo for Women & Men | Hydrates Dry & Dull Hair | 2x Soft & Shiny Hair | No Parabens | 650ml
- Halonix All Rounder Base B22D 15W, 8W, 0.5Watts Multi Wattage Adjustable Light Led Bulb (Pack of 2, White & Yellow)
- beatXP Vista Sonic Electric Toothbrush for Adults with 2 Brush Heads & 5 Cleaning Modes | Rechargeable Electric Toothbrush | 30000 strokes/min with Long Battery Life (Blue)
- he Man Company Deodorant for Men Gift Set | Pack of 4 Body Sprays (150ml Each) | Long Lasting Deodorant for Men | Black, Blanc, Fire & Oud | Premium Fragrance with Musk, Sandalwood, Amber & Patchouli | Daily Office Wear Deo
- Yogabar Breakfast Bars Variety Pack | Daily Protein Bar | High Energy & Nutrition Bars | High Protein and Fibre | Pack of 6 Protein Bar x 45g | No Preservatives
- Clean & Clear Facial Wash 100 ml
- Tata Tea Gold All-in-1 Instant Premix Cardamom Tea, 14g Per Serve, Quick & Easy To Make Cardamom Tea, 10 Sachets
- amazon basics Pro Series 2.4G Wireless Ergonomic Mouse for PC, Mac, Laptop | Dual Modes | 3 Adjustable DPI Settings Up to 2400 | Shortcut Buttons | Connects up to 3 Devices (Black)
- Safari Flash Medium 26L Water Resistant Polyester Casual 4 Compartment Backpack- Blue
- DOVE Exfoliate Away Serum Body Wash, 300 ml, for Refined and Silky Skin, with 4% Refining Serum + AHA, Dermatologist Co-Created, Paraben & SLS Free
- Nike Up Or Down Deodorant Aerosol For Men | Long-Lasting Freshness & Odour Protection | Sporty Masculine Fragrance | 200 ml Each (Pack of 2)
- CELLO Glassy Square Lunch Box with Jacket For Office, Transparent | 2 x 320ml, 2 x 240ml Glass Containers, Microwave Safe Leadfree Toughened Glass, Airtight Leakproof Tiffin Box For Daily Use & Travel
- Unibic Choco Kiss | Limited Edition Choco Filled Cookies | Chocolate Delight | Perfect Gift | 500Gm
- RADIANT Basket Drainer & Dish Drainer Basket for Kitchen/Utensil Stand for Kitchen/Dish Drying Rack with Drainer/Bartan Stand/Dish Rack (Stainless Steel)
- Lifelong Swimming Combo Kit for Kids 5+ Years| Swimming Goggles, Swim Cap with Earplug, NoseClip| Easy Fit Swimming Accessories| Waterproof Swimming Cap| Anti-Fog Glasses(Blue)
- Air Wick 250 ml – Lemon & Orange Blossom, Refill + Automatic Spray| Freshmatic Air Freshener Kit | 2600 Sprays Guaranteed | Automatic Room Freshener, Bathroom Freshener and Room Spray
- Halonix 18W Emergency Inverter Bulb | Rechargeable Emergency B22D Led Bulb For Power Cuts | Backup : Upto 4Hrs | Cool Day Light | Pack Of 1 | Rechargeable Emergency Light
- DOVE MEN+CARE EXTRA FRESH ANTI-PERSPIRANT ROLL ON 50 ML | Provides 48-hour Protection from Odour |
- Elle18 Eyedrama Palette 01Sassy
- Amazon Basics 25W Compact Wall Charger | Type-C Fast Charging Adapter for Samsung, Xiaomi Phones and iPhone (White, Without Cable)
- SELLER ZONE Humidifier With Colorful Light For Room, Bedroom, Office, Car (Grey), 300 ML
- CareFoam Cervical Memory Foam Pillow for Neck Support | 2-Year Manufacturing Warranty | Orthopedic Contour Pillow for Cervical Spine Alignment & Shoulder Support | Made in India | 19 x 11 x 3.5 Inch
- VASELINE Cloud Soft SPF 50 PA ++++ Light Moisturiser, 100 ml, for Soft and Bouncy Skin, with Ceramides & Hyaluron Moisture Fillers, Non-Sticky and Lightweight, Broad Spectrum Protection
- Lifelong Rain Cover for Backpack – Waterproof Dustproof Rain Cover Bag with Elastic Adjustable – Travel Accessories Bag Cover – Suitable for All Bag Sizes Upto 45Ltrs Rain Cover Bag (Black)
- Lifelong Shoe Bags for Travel, Drawstring Travel Shoe Bags for Packing, Dustproof Portable Travel Shoe Storage Bag for Men and Women, Clear, Large, Pack of 6
- Storio S10 Handheld Gaming Console for Kids & Adults | 520 Built-in Classic Games | Retro Video Game Player | Portable Rechargeable Mini Game Box with TV Output | Toy Gift for Boys & Girls 6–14 Years
- Philips LED COB Spotlight | AstraMini Spotlight for Display | Premium & Compact Display Light with 1 inch Cutout | Warm White, Pack of 1
- DABUR Herb’L Activated Charcoal Toothpaste 240G (120G x2, Pack of 2) | Whitening Black Gel Toothpaste | Fluoride Free | Fights Plaque & Extrinsic Stains | With Power of Mint | Cool & Refreshing Mouth Experience
- He Advanced Grooming Respect Perfumed Body Spray, 150ml
- Lifebuoy Total 10 Antibacterial Bodywash 300 ml
- Set Wet Fire Perfume for Men, 100ml|Woody Long Lasting Perfume for Men|Gift for Men|Best Date Night Fragrance
- Park Avenue Oud, Liquid Eau De Parfum Men, 100ml | Long Lasting Perfume Spray For Men | Wedding Gift Ideas | Best Wedding Gifts | Premium Luxury Fragrance Scent Aromatic | Suitable For Every Occasion
- Asian Paints TruCare 12-in-1 Pcs Double Open-End Jaw Spanners Wrench Set | Carbon Steel with Rust & Corrosion Resistant Chrome Plating & Satin Finish | Multipurpose DOE Jaw Spanners Tool Kit
- Cello Steamy Neo Steam Iron, Blue (240 V AC, 50 Hz, 1300 W) | Large Water Tank inlet | Easy Grip Fabric Selector Knob | Scratch resistant Non Stick Sole Plate
- YAJNAS 41×30 CM (WxH) Non Magnetic Drywipe Whiteboard/Lapboard Small Slate
- Havells Crystal Tea-Coffee Maker Glass with Filter Basket | Indicator Light | Transparent Glass Carafe 600 W
- Dove Original Deodorant Roll On For Women|| 50 ml+ For DROB100
- American Tourister Polyester Harp Duffle Bag 52 Cm Teal, Duffel Bag for Travel, Gym Bag for Men, Women, Durable with Strong Zips, Overnighter
- ZEBRONICS 250HB Multiport HUB, 3 USB Ports, USB 3.0, SD Card Slot, mSD Card Slot, Transfer Speeds Upto 5 Gbps, Lightweight Design, Multi OS Compatible, Plug and Play
- ThriveCo Scalp Vitalizing Serum | Tightens Scalp Skin, Combats Inflammation, Gives Hydration, Prevents Hair Breakage & Promotes Hair Growth & Strength | For Men & Women | Travel-Friendly (10 ml)
- Clazkit 25 Pack Areca Deep Pyramid Bowl | Like Wooden Bamboo | Eco Friendly, Biodegradable, Use and Throw Small Dona | for Serving Pasta, Soup & Snacks | Birthday, Wedding & Party (6.5 Inch)
- Modern LED 3 Ring Pendant Chandelier Light | Contemporary Hanging Ceiling Lamp | Warm White Decorative Lighting Fixture | Gold Finish | Ideal for Dining Room, Living Room, Kitchen Island & Hall
- Cello Aqua Leaves Dazzle Series Opalware Dinner Set, 37 Pieces, Service for 6, White, Extra Large (Model: CLO_OPLWR_DZZL_AQLVS_DS_37PCS)
- Boat Storm Call 3 w/Turn-by-Turn Navigation, 1.83″ (4.6 cm) HD Display, Bluetooth Calling, Crest+ OS, QR Tray, Watch Face Studio, Coins, Emergency SOS Smart Watch for Men & Women
- Secret Temptation Perfume for Women Gift Set – Daisy & Jazz (2 x 30ml) | Premium Perfume for Women Long Lasting Fragrance
- HP Campus Core 16 Laptop Backpack – Blue
- Orient Electric Eternal Shine LED Bulb | 30 Watts | 12 Months Warranty | Cool White (Pack of 1) | 25000 Hours + 180 degree coverage | BIS Certified
- Zebronics Wireless Mouse, Dual Mode 2.4GHz + Bluetooth, Up to 1600 DPI, 6 Buttons, USB Nano Receiver, Ergonomic Design, Plug and Play (Curve)
- Glamveda Glycolic Acid & 0.05% ww Salicylic Acid Anti Acne Face Wash (100ml Pack of 2) | For Oily & Acne Prone Skin | Oil balancing, Deep Cleansing | No Paraben, SLS
- Dabur Herb’l Activated Charcoal & Mint Toothpaste – Star Wars Pack (Black Gel)- 240g (120gx2) Combo Pack | For Whitening | Fluoride Free Toothpaste | Fights Plaque & Extrinsic Stains
- Boat Bassheads 95 Wired in Ear Phones,10Mm Drivers,Signature Sound,in-Line Microphone,Integrated Controls,Snug Fit,Lightweight,Voice Assistant,120Cm Cable & 3.5mm Jack (Spirit Lime)
- Engage Yang Eau De Parfum for Women 50ml |Floral Fruity|Long Lasting Perfume| Everyday Luxury |Perfume for Woman| No Paraben | No Silicones| Dermat-Tested EDP| Gift for Woman|Also Try Maracuja Wine
- Beardo Don & Mariner Perfume for Men, 20ml x 2 | Mariner EDP with Fresh Aqua Notes for Men Long Lasting Perfume for Date night fragrance | Spicy Musk Don fragrance | Ideal gift for men | Rakhi Gift for Brother | Gift for boyfriend | Gift for Men | Gift for Brother
- Vim Matic Dishwasher tablets All-In-One (Pack of 30) I Removes Tough Indian Grease I Designed By India’s No.1 Dishwashing Brand
- Amazon Basics Laptop Bag Sleeve Case Cover Pouch for Men & Women | 14.1 Inch Laptop/MacBook, Office/College Laptop Bag | Side Handle | Multiple Pockets | Water Repellent | Shock Absorber (Black)
- Halonix Bug Zapper Anti-Mosquito Racquet, Insect Killer Bat with Rechargeable 400 mAh Battery | Mosquito bat | Fly swatter | Orange
- Philips 14W Emergency LED Bulb | Stellar Bright B22 Inverter LED Bulb for Power Cuts | Crystal White, Pack of 1
- Vedaka Cane Jaggery Powder | 1 Kg Jar
- Parachute Advansed Protein Shampoo | with Coconut Milk and Aloe Vera | For up to 100% Damage Repair & up to 3X Softer Hair | Protein Lock Technology | Paraben-Free | For Men & Women | 340ml
- APFEN® 27W Type C to Lightning Fast Charging Cable With High-Speed Data Transfer Compatible with iPhone 14/14 Pro/ 14 Pro Max/ 13/13 Pro/ 13 ProMax/ 12/11/XR/XS/X/8 S
- Boat Nirvana Ion, 120HRS Battery, Crystal Bionic Sound w/Dual EQ Modes, 4Mics ENx, App Support, Low Latency, IPX4, v.5.2 Bluetooth TWS in Ear Earbuds Wireless Earphones with mic (Ivory White)
- Aristocrat Enigma 52 Cm Polyester Softsided Cabin Size Duffle Bag – Red
- RIN Matic Liquid Detergent, 2Kg, for Dazzling Brightness, with Bright Lock Technology, Long-Lasting Fragrance, for Front Load Washing Machines
- Cetaphil Gentle Exfoliating SA Lotion 29ml | Lightweight Daily Moisturizer with Salicylic Acid, Mandelic Acid & Gluconolactone | 48 Hr Hydration & Gentle Exfoliation | For Sensitive Skin
- Everyuth Naturals Rejuvenating Cucumber & Aloe Vera Sheet Mask Pack of 3
- Patanjali Haldi Chandan Kanti Body Cleanser Soap for Men and Women(150g, Pack of 4), Nourishing & Moisturizing, Natural Aloe Vera Soap for Soft Skin
- Revlon Super Lustrous Lip Gloss, Non-Sticky, Hydrating, High Shine Finish, 255 Sandstorm, 0.13 oz
- Safari 15 Litre Casual/School/College Standard 2 Compartment Backpack
- Maxkleen Disinfectant Surface Sanitizer with BKC Solution and No Bleach, 500ml
- CELLO MF High Meal Combo Lunch Box Set with Bag, Blue | Set of 3 x 300ml Steel Containers + Steel Tumbler 510ml | Food Grade, Easy to Carry Air Tight Leak Proof Lunch Box Set Office, College, Travel
- Bombay Shaving Company Mexico Perfume for Men | Woody Long Lasting Fragrance | Eau de Parfum | 10ml
- HALONIX Twinkle 10M Blue 46 LED Decorative String Light | Diwali Light | Fairy Light | Festival Light | Curtain Light for Decoration | ladiya for Diwali, Christmas, and Other Occasions.
- Selleys RP7 (105 Ml, Clear) Multipurpose Lubricant,Cleaner for Chimney,Rust Remover, Auto Maintenance,Loosens Stuck Parts, Removes Stain & Sticky Residue, Descaling & Cleaning Agent
- LuvLap Baby Lotion with Milk Protein – 400ml, Gentle Daily Lotion for Face & Body, 24 Hour Protection for Sensitive Skin, Ph 5.5, Shea Butter and VIT E, Paraben Free, Dermatologically Tested
- LuvLap Baby Wash – 400ml, with Milk Protein, Oatmeal, Shea Butter and Vitamin E, Soap Free, Baby Wash for Baby Bath, Natural, pH Balanced & Paraben Free, Dermatologically Tested
- boAt PartyPal 30, 25W Signature Sound, RGB LEDs, Wired Mic for Karaoke, Up to 6H Battery, TWS Mode, Multi Connect, Bluetooth Speaker, Wireless Speaker, Portable Speaker (Premium Black)
- Himalaya Kids Cool Mint Toothpaste 80 Gm
- True Elements Steel Cut Oats 500 g*2 – Diabetic Friendly | High in Protein and Fiber | Gluten Free Oats | Healthy Breakfast Cereals
- BEARDO Whisky Smoke Perfume Giftset for Men | Eau De Parfum 100ml + Body Spray 120ml | Spicy, Woody – Oudh | Long Lasting Perfume | Date night fragrance | Gift for Men | Husband | Boyfriend
- Park Avenue Luxury Perfume Gift Set for Men, 4×20 ml | Euphoria, Conquer, Harmony & Discoverer Perfume | Eau De Parfum | Premium Luxury Perfume for Corporate Man | Perfume for men Long Lasting Smell
- Whisper Super Absorbent Period Panty, 12 L-XL Pants, 360 Degree Leakage Protection* for Heavy Flow, Panty like Fit, Full back Coverage, Absorbs Heavy Gushes, Silky Soft, Comfortable Feel
- Gesto 3-in-1 Portable Car Vacuum Cleaner, Air Duster & Inflator | 70W High Power, 12000Pa Brushless Motor, 4000mAh Type-C Rechargeable Cordless Handheld Vacuum with Multi Nozzle for Car,Office,Home
- ATTRO Joy Kins Plastic Lunch Box – 3 Compartment Bento Tiffin, Leak-Proof & Durable, Plastic Spoon, Ideal for Kids, School, Picnic– 1260ml, Blue
- Beardo Whisky Smoke Solid Perfume 10g, & Whiskey Smoke Perfume 50ml (Set of 2) | Strong & Long Lasting Fragrance | For Date Night | Rich and Lasting Fragrance Combo for Men, Ideal for Daily Use
- Boat Stone 1200 Pro, 60W Boat Signature Sound, 76.2mm Drivers, TWS,7.5H Battery, Built-in Mic, Carry Strap,IPX6, Bluetooth Speaker, Wireless Speaker, Portable Speaker (Twilight Black)
- Philips 18W B22 LED Cool White T-Bulb, Pack of 2 (929001923213)
- Halonix 10 Watts B22d LED bulb tube Light Cool White, Pack of 1, T-bulb
- Nayasa Sqr Ring Marble Bucket 18 LTR | Set of 2 | Bathroom Set | Bath Set for Bathroom | Bucket | Grey
- Yardley London| Shower Gel| Floral Essence| With Natural Floral Oils Of Gardenia & Waterlily| No Parabens| No Silicones | 500ml
- DABUR Kesar Ubtan Face Wash-100ml | Enriched with Natural Turmeric, Niacinamide & Saffron to Brighten, Tone and gently Exfoliate Skin | For Removing Tan, Dark Spots, Dirt & Impurities
- Eveready Base B22D 7-Watt LED Bulb (Cool Day Light)
- Dove Hydration Boost Serum Body Wash | 6% Hydrating Serum with Hyaluronic Acid | For instantly plump & dewy skin | Paraben & SLS free | 300 ml
- Amazon brand- Amazon Basics 2-Ply Facial Tissue paper 600 pulls | 200 pulls x Pack of 3| Soft & Gentle| Chemical-Free
- One94Store Portable USB Desk Fan, 1800mAh Rechargeable Handheld Fan with Stand, 3 Speed Low Noise Personal Cooling Fan, Up to 4Hrs Runtime for Home, Office & Travel (Creamy White)
- Beardo Whisky Smoke Bourbon Perfume 50ml & Mariner Perfume 50ml Combo | Long Lasting Perfume For Men | Oriental, Woody, Leathery | Fresh, Aqua Notes | Gift Set | Rakhi Gift for Brother | Gift for boyfriend | Gift for Men | Gift for Brother
- Glucon-D Instant Energy Drink Powder Jar 400 gm | Energy, Recovery, Immunity | Tangy Orange
- BEARDO Whisky Smoke FIREBOMB Perfume for Man, 100ml | Spicy, Woody scent | EAU DE PARFUM | Perfume For Men| Long Lasting Fragrance | Date Night Perfume | Premium Fragrance | Gift for Men | Husband | Boyfriend
- Bagrry’s Crunchy Dark Chocolate Muesli 700g / 750g | 100% Belgian Dark Chocolate Muesli | 86% Fruits, Nuts, Cocoa & Grains | No Artificial Ingredients | High Fibre Breakfast Cereal
- Himalaya Baby Tummy Roll On (40ml) with 5 Natural Oils including Hing, Saunf, Cardamom | Eases Tummy Discomfort & Indigestion | Pediatrician Tested | Clinically Tested
- Fevicreate Tissue Art Kit | Create 5 Exciting Templates to Using Tissue, Glue Drops, Fevistik & More | Boost Child’s Creativity | by Fevicol | Best Gift for Kids Boys & Girls Age 5+ Years
- pTron Studio Sports Wireless BT Gaming Over-Ear Headphones, 30MS Low-Latency for Thrilling Gaming Experience, RGB Lights, Boom HD Mic w/AI ENC, 60Hr Playtime, Punchy Sound, Type-C Fast Charging(Sable)
- Yardley London| Shower Gel| Floral Essence| With Natural Floral Oils Of Iris & Violet| No Parabens| No Silicones 500ml
- neelam Stainless Steel Lunch Box/Tiffin with Locking Clip, 4-Tier Container, 1500 ml, Hot & Cold Leak-Proof, Compact & Durable, Perfect for Office, School, Picnic and Travel, Silver
- Cello Plastic Step-On Pedal Garbage Dustbin (50 L, grey-grey)
- Solimo Rolled Oats | 2 Kg | Contains 100% Oats | Source of Protein | Quick Breakfast – Cooks in 3 Mins
- La French Cuddle Perfume Scent For Women 30 ml | Premium Luxury | Long Lasting | Eau De Parfum | Signature Scent | Date night fragrance | Ideal gift for Women
- LONGWAY Gusto 6 Inch 150 mm Energy Efficient Exhaust Fan | High Speed Powerful Motor | Noiseless Operation & Easy to Clean | Suitable for Bathroom, Kitchen, Office | 2 Years Warranty (Ivory)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 28th June 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 28th June 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 28th June 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato