Pages
- Best Laptops Deals August 2026
- Best Smart Watches August 2026
- Mobiles
- Amazon Deals & Offers for August 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 9th August 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Lenovo L-Series 27 inch (68.5cm) QHD IPS Monitor| 100Hz, 1ms, FreeSync, 99% sRGB, 90% DCI-P3, 3Wx2 Speakers, 2X HDMI 2.1, 1x DP 1.4, Tilt, Swivel, Pivot Height Adjust Stand, Grey, L27q-4A
- Amazon Basics A4 Copier Paper | Multipurpose Paper | 75 GSM | 500 Sheets | Compatible with Inkjet & Laser Printers
- Faber-Castell Bi-Colour Pencil, Pack of 18 (Assorted)
- Little Colouring Book – Flowers
- Zebronics 21.5” (54.6cm) LED Monitor, FHD 1920×1080, 250nits Brightness, Dual Input – HDMI/VGA, 2000000:1 Dynamic Contrast Ratio, 16.7M Colors, 16:9 Aspect Ratio, Wall Mountable (EA 122)
- pTron Bassbuds Blaze in-Ear TWS Earbuds w/ 13mm Drivers, 50Hrs Playtime, AI-ENC Clear Calls, Bluetooth V5.4 Wireless Headphones, Touch Control, Voice Assistant, Type C Charging & IPX5 (Berry)
- Whirlpool 8 Kg 5 Star Inverter Supreme Care Front Load Fully Automatic Washing Machine with In-Built Heater (XS8014BWME, MidNight Grey, Steam Technology, 100+ Tough Stains, 6th Sense Soft Move)
- Prestige Judge ACE Outer Lid Easy Grip Handle|Long Lasting Regulator|Durable Gasket 5 L Induction Bottom Pressure Cooker (Stainless Steel)
- MILTON Procook Triply Stainless Steel 4pc with Wood Handle Saucepan Frypan Kadhai & lid Induction Bottom Cookware Set (Stainless Steel, 4 – Piece)
- Minimalist Premium Kundan Lotus Floral Rakhi For Brother Pack Of 1/2/3/4/5 | Designer Traditional Handmade Pearl Raksha Bandhan Moli Thread Bracelet Combo For Bhai, Bhaiya, Sister, Sister In Law, Men, Kids, Teens & Boys
- MILTON Plastic Utility Container – 1100 ml (Pack of 6, Black)
- cello Ozone ISI Certified Single Wall Leakproof & Rustproof 1000 ml Stainless Steel Bottle (Pack of 3, Silver)
- realme TechLife 7 kg Semi Automatic Top Load Maroon, White (RMSA705NNNHMA)
- Ant Esports Crystal Z2 Mid-Tower Computer Case/Gaming Cabinet – White | Support Micro-ATX, Mini-ITX | Pre-Installed 3 ARGB Infinity Mirror Fans
- ANT Wireless Keyboard and Mouse, Silent Keyboard Mouse Combo, Full-Sized Colorful Typewriter Keyboard with Round Keycaps, 2.4G Cute Mouse Compatible with PC/Laptop/Compute – Blue
- Baby Dove Shampoo 400 ml, Mild No Tears Rich Moisture Baby Shampoo for kids, Gentle Care for Baby’s Soft Hair – No Sulphates No Paraben shampoo
- Larah by Borosil – Tiara Series, Foliage, 21 Pcs, Opalware Dinner Set, White
- ZEBRONICS Sonic POD S, Portable Bluetooth Speaker, 8 Watts, Upto 7h Backup, Passive Radiator, Call Function, Bluetooth v5.3 | mSD | AUX, TWS, with Carry Loop (Green)
- Cult Deep Relax Shoulder Massager, Hand Simulating rollers for Pain Relief, Cordless Massager (Black)
- Mancode Luxury Soap Gift Set For Men With Pack of 5 Menthol Soap Bars | Deep Cleansing Soap | Provides Natural Glow | Daily Bathing Bar Soap For Men For All Skin Types. (Pack of 5) (625g)
- Nirlon Red Stone Induction and Gas Compatible Non Stick Aluminium 3 Piece Cookware Set {1 Fry Pan 240mm – 1.5 Liter|1 Kadhai 240mm – 3 Liter|1 Glass Lid}
- Targus ASM154MBP6AP-60 15.4-inch Magnetic Privacy Screen (Black) for Apple MacBook Pro
- LAKMÉ Lipstick 14 Nude Reign (Matte) & LAKMÉ Peach Milk Moisturizer Body Lotion 60 Ml
- LG TONEFree Fit TF7Q True Wireless Earbuds, Active Noise Cancellation, IP67, 3D Sound Stage, UV Nano, Game Mode, 30 Hour Battery, Swivel fit Technology
- HP Omnibook 3, Snapdragon X Processor 45 TOPS (16GB LPDDR5x,512GB SSD) 2K WUXGA, Anti-Glare, 14”/35.6cm, Win 11, M365*Office 24,Silver,1.42kg, hz0026QU, Lighter mini Charger, FHD IR Camera, AI Laptop
- LG 164 cms (65 inches) U8 AI Series 4K Ultra HD (3840 x 2160) Smart webOS LED TV 65NU870BPLA 2026
- Portronics My Buddy F Multipurpose Movable & Adjustable Laptop Table(Black)
- AO Smith Geyser 6 Litre 5 Star Rating (BEE) | Powerful 2KW Heating | Storage Water Heater With 2X Corrosion Resistant Blue Diamond Glass Tank | Warranty: 5 Yr Tank, 2 Yr Comprehensive | HSE-SHS-06
- Symbol Men’s Cotton Printed Boxer Shorts (Combo Pack of 2) Casual | Underwear | Half Pants | Short Pant – Regular Fit with Back Pocket
- Fossil Decker Brown Watch
- Cortina 80-90% Blackout Solid Window Curtains 5 Feet Set of 2 – Thermal Insulated | Curtain for Living Room | Drapes for Bedroom | (5 Feet, Brown)
- Chef Knife with Leather Sheath, Full Tang Kitchen Knife with Ergonomic Wooden Handle, Multipurpose Stainless Steel Blade for Cutting Meat, Vegetables, Fruits (Kitchen Knife)
- Sounce Mouse Pad 9.6×7.9×0.1 inch, Ultra-Smooth Tracking Surface for PC & Laptop, Durable Stitched Edges, Non-Slip Rubber Base, Washable Computer Mat, Anti-Fraying Design (2026 Calendar) Black
- Ray-Ban | Meta Wayfarer (Gen 1) Large – Matte Black, Polarised Gradient Graphite Lenses
- TIMEX Analog Watch for Men Available in Black, Champagne Dial & Multicolor Stainless Steel Bracelet Band – Water Resistant Wrist Watches
- Lifelong LLM171 Powerful Electric Handheld Full Body Massager|Pain Relief of Back, Neck and Foot Massager (Grey)
- ASUS TUF A15, AMD Ryzen 7 170, RTX 3050-4GB, 16GB RAM (Upgradeable), 512GB SSD, FHD, 15.6″(39.6 cm),Windows 11 Home,Graphite Black, 2.3 Kg, FA506NCQ-HN006W, Gaming Laptop
- Cortina 80-90% Blackout Solid Door Curtains 9 Feet Set of 2 – Thermal Insulated | Curtain for Living Room | Drapes for Bedroom | (9 Feet, Beige)
- Kratos N1 Neckband Bluetooth Headphones with 30 Hours Playtime with 13mm Drivers, Rich Music Experience, Type C Fast Charging, Neckband Earphones with Voice Assistant & IPX4 Water Resistant
- Kidsmate Bunny Ride On for Kids | Baby Car Features Music, Horn, Backrest, Safety Guard, & Storage | Toy Car for Kids Ensuring Smooth & Fun Play with Big Wheels | Push Car for 1-3 Years (Blue)
- MILTON Hydrameal Combo Set Lunch Box with Insulated Jacket & 490 ml Water Bottle, 3 Containers (450 ml, 280 ml, 280 ml), Microwavable & Leak-Proof Tiffin for Office, School & College, Purple
- Jam & Honey Panda Popup Play Tent for Kids | Foldable Animal Themed Tent House | for Boys and Girls from 1 to 4 Years | Easy to Set Up | Green
- Cortina 2 Pcs Kitchen Mats, Waterproof Memory Foam Kitchen Rugs, Standing Desk Mat Floor Mats, Comfort Runner Rug Carpets for Kitchen Floor, Sink – (120 * 40 cm, 40 * 60 cm, Maroon)
- Bluetooth Pillow Speaker for Sleeping | Wireless Under Pillow Sleep Speaker with White Noise Timer | Rechargeable Mini Stereo Speaker for Side Sleepers, Adults & Kids
- Cortina Solid Towels for Bath Set of 2 (70 x 140 cm) 300 GSM Microfiber Bath Towels, Ultra Soft, Highly Absorbent & Quick Dry for Gym, Beach & Bathroom Towels for Men, Women & Kids (Grey/Marron)
- Lenovo IdeaPad Slim 3 Intel Core Ultra 5 322 Next-Gen AI PC (16GB RAM/512GB SSD/15.3″ (38.8cm)/WUXGA IPS/Copilot+ PC/Windows 11/MSO 365 Basic+Office 2024/Backlit Keyboard/Grey/1.6Kg), 83UR009QIN
- Amazon Basics Stylish Shock-Absorbing Protective Case with Keychain for AirPods Pro Gen 1 & Gen 2 | Visible Front LED | Sophisticate Design (Black)
- KOTTY Women Tracksuit
- DOCTOR EXTRA SOFT Care Diabetic Orthopedic Pregnancy Flat Super Comfort Dr Flipflops and House Slippers For Women’s and Girl’s
- Treo by Milton Opalware Aurelia Murel Dinner Set of 18 | Serving for 6 | Microwave & Dishwasher Safe | Bone-Ash Free | Tempered Toughness | Plates & Bowls | Crockery Set for Dining & Gifting
- 7 in 1 Travel Packing Cubes Organizer Set with Mesh Packing Bags, Shoe Bag, Laundry Bag, Zipper Pouch & Toiletry Organizer, Travel Luggage Organizers for Clothes, Cosmetics & Accessories (Dark Blue)
- DOCTOR EXTRA SOFT Thong Arch Support Ortho Slippers for Mens| Orthopedic Diabetic & Stylish| Lightweight Comfortable & Casual| Cushion Anti-Skid Bedroom Daily Use House Flip-Flops Gents Boys NEW-D-38
- Signoraware Perfecto 4 Coating Non Stick Kadhai 24cm | Gas & Induction Compatible | Low-Oil Cooking | Ergonomically Designed | Ideal for Frying, Sauteing or Preparing Rich Curries (2.5 LTR | Steel)
- Shilajit/Shilajeet Pure Himalayan Resin Gold Grade 20g | 500mg Serving | 40 Servings | Boost Muscle Growth & Stamina Fulvic Acid with Lab Test Report Approved by Ministry of Ayush Government of India
- Crompton 8.5W Backup Lamp 4 hrs Bulb Emergency Light (CDL)
- Motion Sensor LED Light for Home 30cm Rechargeable | Motion Activated, Rechargeable Battery, LED Technology, 30cm Size, Indoor Use
- boAt Airdopes Plus 311, Glass Design, ENx Tech, Fast Charge, 50 Hrs Battery, Stream Ad Free Music via App Support Bluetooth Earbuds, TWS Ear Buds Wireless Earphones with mic (Charcoal Black)
- OnePlus 15 | 12GB+256GB | Infinite Black | India’s First Snapdragon® 8 Elite Gen 5 | 7300mAh Battery | Personalised AI | Game-Changing 165Hz Display | Triple 50MP Camera with 4K 120fps Dolby Vision
- Blaupunkt Live Portable Pocket Friendly Bluetooth Speaker I Deep Bass I Built-in Mobile Stand I TWS Function I Built-in mic for Phone Calls/Work from Home I Outdoor Ready(Black)
- DiSano Classic Peanut Butter Crunchy, 924g, 25g Protein, Roasted Peanuts, Ideal for Pre & Post-Workout, Healthy Spread for Breakfast & Snacking
- SJCAM SJ10X Optical 12 MP 4K24fps | 5.91 cm (2.33″) UHD IPS Touch Display Action Camera | 10M Waterproof Body | Gyro Stabilization | Mono (1 Internal Microphone) | VLOGING, Black
- Patanjali UV Pro Advance Sun Defence Cream SPF 50 PA+++50g, Dry Touch, Non-Oily, Non-Sticky Sunscreen for All Skin Types, Ayurvedic Sunblock, Broad Spectrum UVA/UVB Protection Pack of 1
- ClarityLabs Oil Control Anti Acne Soap For Face & Body | Pack of 4 | With Salicylic Acid, Zinc PCA, Charcoal, Tea Tree Oil & Vitamin C | Reduces Dark Spots, Acne, Strawberry Skin & Body Acne | Regulates Sebum & Reduces imfllamation | For Women & Men | 4 Soaps Pack
- 3-Piece Kitchen Knife Set with High Carbon Stainless Steel Blades, Chef Knife, Utility Knife & Santoku Knife with Ergonomic Black Handles for Chopping, Black 3pcs Knife Set
- Origami So Soft Plain Napkins | CT | 1 Ply | Pack of 3 | 100 Pulls Each
- Ayuvana Plant Protein Powder with Prebiotics & Probiotics Plant-Based Protein (500 g, Brazilian Mocha)
- Origami Online Facial Tissues | Soft Pack | Pack of 6 | 100 Pulls Each
- Kuchipoo Boys Regular Fit Cotton T-Shirts and Pyjamas Clothing Set-Pack of 3
- Desidiya® LED Outdoor UP Down Wall Light (Pack of 1) IP-65 Rainproof & Shockproof Alluminium Body 4 Way Exterior Wall Step Light Fixture (Warm White)
- GRAPHENE RC 4×4 Formula F1 Drift Smoke Stunt 4WD Remote Control Car Toy for Kids 1:14 Scale 2.4Ghz Hand Sensor Gesture 360° Rotation 3 Lights Music Spin Sports Racing Cars 4+ 5+ 6+ Boys Girl Adults
- POZET 3D Brick Wallpaper PE Foam self Adhesive Brick Design Wall Stickers/DIY Wallpaper for Home Hotel Living Room Bedroom Cafe Deco (70 x 77 cm) – White
- Presto! 2 Ply Kitchen Tissue Paper Roll | 120 Pulls | 60 Kitchen Towels X 2 Rolls | Soft And Highly Absorbent | 100% Natural Virgin Cellulose Fiber
- Alite Neem & Turmeric Soap for Skin Purification & Natural Glow | Herbal Bath Soap with Neem Oil & Turmeric Extract | Cleanses Tan Build-Up, Supports Even-Toned Skin | Men Women | Paraben-Free | 75g Each Pack of 3
- Woodland Men’s Running Shoe
- Insta360 X4 Air Starter Bundle – Lightweight 165g 8K 360 Camera, Invisible Selfie Stick Effect, Replaceable Lenses, Shoot First & Frame Later, Built-in Wind Guard, AI-Powered App
- Tizum Mouse Pad with Anti-Slip Rubber Base & Ultra-Smooth Surface | Washable, Spill-Resistant Print Design, Computer Mouse Mat for Laptop, Desktop & Office
- Aristocrat Airpro Max 8-Wheel Cabin, Hard Case Trolley Bag, Mojave Desert | Durable Polypropylene Case, Lightweight, Combination Lock, Sturdy Zipper, Compact Travel Luggage, 3-Year Global Warranty
- Aqueria Pack of 3 Underarm Brightening Roll-On for Men & Women | Lactic Acid, Fermented Rice Water & Glycerine | Helps Reduce Dark Underarms, Pigmentation & Uneven Skin Tone | Controls Body Odour | Fresh Fragrance | (50ml x 3)
- Haier 10Kg,5 Star,AI Smart LIFE+,Vibrant Touch Panel, 525 mm Super Drum, Refresh,WiFi enabled,Fully Automatic Front Load Washer(EFL100-IM14F5ES8U1 | Dark Jade Silver)
- Ambrane 20000mAh Powerbank with in-Build Type C Cable, 22.5W Fast Charging, USB & Type C Output, Power Delivery, Quick Charge for iPhone, Android Mobile & Tablets, Earbuds, (Stylo N20, Black)
- Halonix 10 Watts B22d LED bulb Mini tube Light| Color- Warm White Light | Pack of 1
- Forest Found Roasted Salted Edamame (825g) | Protein (46%) & Fiber (14%) | Oil-Free, Vacuum Roasted Crunchy Green Soybeans | Healthy Low Carb, Plant-Based Snack | Young Green Soybeans
- Acer Smartchoice Aspire One, AMD Ryzen 5-40, 8GB LPDDR5 RAM/ 512GB SSD, 14.0″/35.56cm WXGA Display, Win 11 Home, Pure Silver, 1.48KG, A114-43, Thin and Light Laptop
- Lifelong Air Fryer Oven 10L | 12 Preset Modes | 1350W Power | Healthy Low Oil Cooking, Rapid Air Technology, Glass Lid | LED Touch Display | Nonstick Easy Clean Kitchen Appliance with Oil Drip Tray
- Hafele Magnus Prime Cold Press Juicer, 100mm Wide Chute, All-in-1 Fruit & Vegetable Juicer, 50RPM Speed for Max Nutrition,Maximum Extraction of Juice, 250W
- FREECULTR Pack of 2 Solid Men Trunk
- Orient Electric Moonlite 6W LED Ceiling Light, Cool White Light, Round, Pack of 1, Recessed Ceiling LED Light, Suited for 3 inch Junction Box (Aluminium) (6W, Pack of 1)
- Orient Electric 12W Rimless LED Surface Panel Light | 990 Lumens | Wide Voltage Operation | Up to 4.0 kV Surge Protection| Cool White Light| BIS Certified | Made in India| Pack of 1
- Plantex Heavy-Duty Door Lock Set – Main Door Handle Set/ 6-Lever Lock Mechanism with 3 Years of Warranty by Plantex/Mortise, Brass Lock Body & Cylinder (8114 – Satin Black & PVD Choco)
- AGEasy (Max Group) Massage Gun, 8 Speed, 4 Massage Heads, Rechargable USB Type – C Massager (Black)
- eCraftIndia Set of 5 Red & Golden Om Symbol and Lord Ganesha Designer Religious Rakhi with Roli Chawal Pack and Best Bro Ever Fridge Magnet – Rakhi for Brother, Bhaiya, Bhai
- Just Herbs Ayurvedic Creamy Matte Burnt Red Lipstick for Women – Paraben Free (Burnt Red, 4.2 g)
- Cockatoo SmartRun 4.0 4HP Peak DC Motorized Treadmill for Home, With 3 Level Manual Incline, Max Speed 14 Km/Hr, Max User Weight 120Kg ,(DIY, Do It Yourself Installation)
- Zebronics USB300WF1 WiFi Dongle Mini Adapter,Supports 300Mbps Wireless Data Transmission Rate with Access Point Mode for Hotspot (Black)
- PHILIPS 12 Watt Chrome Reflector LED Ceiling COB Round Spot Light with Focused Beam | Cut Out: 102mm | Cool Day Light, Pack of 1 (Deco Bright)
- Iconics Women’s Slip On Ballerinas, Colour-Black, Size-UK 6
- Baby Rompers Pack of 2
- SMK Stellar Sports Stage Full Face Helmet with Pinlock Fited (Ma262)-L, Black,Pinlock 30 Fitted
- Dettol Dishwash liquid and Kitchen Gel || Cuts Tough Grease || Remove germs || Lemon Fragrance ||1500ml (Refill Pack)
- Halonix 10W B22 LED Cool Day Light Bulb, Pack of 10
- Halonix 10W Cool Day Light LED Light, Pack of 1, (F5BMM030040000000 PK1) B22D, White
- Vaseline Aloe Fresh Body Lotion,24 HR Long Lasting Moisturisation with Aloe Vera extract and Menthol, 600ml
- Clazkit 3-Layer Kitchen Rack | Multipurpose Storage Organizer for Kitchen, Fruits & Vegetables, Bathroom & Utility Room | Durable Space-Saving Rack with 3 Spacious Shelves | Easy to Assemble
- Origami So Soft Toilet Tissue Paper | 3 Ply | Pack of 12 | 140 Pulls Each
- Pears Original Glycerin Soap Bar – Pure & Gentle Glow | With 98% Pure Glycerin | For Hydration & Glow | With Plant Based Cleanser for Skin & Body | Paraben-free | 125gms x 5
- Gear Superior 17″/19L Medium Water Resistant Backpack | Casual Backpack | Daypack | Travel Backpack | College Bag For Men/Women (Black – Grey)
- VASELINE Cloud Soft SPF 50 PA ++++ Light Moisturiser, 200 ml, for Soft and Bouncy Skin, with Ceramides & Hyaluron Moisture Fillers, Non-Sticky and Lightweight, Broad Spectrum Protection
- Philips 40 – watt LED Bulb | AceBright High Wattage LED Bulb | Bulb Base : B22, Light Bulb for Home | Colour : Cool Day Light, Pack of 4
- NIVEA Lip Balm, Fruity Peach Shine,4.8 g (Pack of 1)
- Lifelong 4 piece Stainless Steel cookware Set | 22 cm Kadai & Fry Pan 22 cm with Glass Lid | 14 cm Sauce Pan | Sandwich Bottom | Induction & Gas Stove Compatible (Silver, LLSSKFS01)
- Clazkit 3-Set Tray for Kitchen & Dining | Multipurpose Serving Tray with Easy-Grip Handles | Tea, Coffee, Snacks & Food Serving Tray
- Clazkit 2-in-1 Cute Bear Shaped Water Bottle with Straw & Adjustable Strap | Leakproof Kids Sipper Bottle | BPA-Free Reusable Water Bottle for School, Travel & Outdoor Use – 900ml (Green)
- Boat EnergyShroom PB300 Neo 10000mAh Power Bank with 22.5W Fast Charging, 3X Output Ports, Supports Android, iPhone, Tablets, Earbuds (Phantom Black)
- YOUVA Navneet Spiral Long Book For Students And Executives | Spiral Bound With Safety Lock | A4 Size – 21 X 29.7 Cm | Single Line | 300 Pages | Pack Of 1
- Eightiz Basket Drainer Dish for Kitchen Sink, Multipurpose Plastic Drain Basket with Water Drain Holes, Space Saving Fruit, Vegetable Garden & Utensil Washing Basket for(Stainless Steel)
- Philips Polycarbonate (Pc) Led Cob Spotlight Astramini Spotlight For Display Premium & Compact Display Light With 1 Inch Cutout Warm White, Pack Of 1, 1 Watt, b22d
- Baidyanath Ayurved Chyawanprash 1 KG | Helps in Improves Respiratory and Digestive Health, Strength and Stamina | Enriched with 39 Vital Ayurvedic Herbs like Amla, Ashwagandha
- amazon basics TWS in-Ear Earbuds (AB-T01B) with Fast Charging up to 80 Hours of Playtime | Dual 10mm Driver | IPX4 Water-Resistance | Bluetooth 5.3 | Charging Case with Mic | Touch Control (Blue)
- Sensilo 2 in 1 SteelWood Chopping Cutting Board, One Side Steel One Side Teak Wood, for Vegetable,Fruit,Bread & Durable Safe & Heavy Duty, (36 x 24 cm, Steel Wood)
- BSB HOME Luxury Reversible Comforter Double Size | Dual Color Soft Quilt for AC Room | Winter & Summer | Rainy Season Plush Microfiber | Solid Color Comforter – 90×100 Inches, Black & Grey
- AGEasy (Max Group) Unisex Adult Diaper Pants | M (Waist 24-45 inches) | 10 Units | Overnight Leak Protection | Wetness Indicator | Odour Lock | Anti-Bacterial | Skin Friendly
- Heaven Decor Brass and Glass akhand deep Diya with Cover for Puja | Deepam Jyot Diya Oil Lamp | Pooja Articles and Pooja Items for Home Temple 4.8 inch
- ZEBRONICS Zeb-Jaguar Wireless Mouse, 2.4GHz with USB Nano Receiver, High Precision Optical Tracking, 4 Buttons, Plug & Play, Ambidextrous, for PC/Mac/Laptop (White+Grey)
- MarwarBites Premium Chia Seeds 1kg | Raw Unroasted & Cleaned | Natural Plant-Based Superfood Seed For Eating | Ideal for Smoothies, Baking & Cooking
- Lifelong Adjustable Washing Machine Stand with Wheels, Heavy Duty Steel Trolley for 5 Kg to 12 Kg Top Load & Front Load Washing Machines | Fridge & Air Cooler Stand | 180 Kg Capacity | Anti Vibration Pads | Black
- Fitness Mantra® 12 Pairs Sports Ankle Cotton Socks | Free Size| Breathable| Daily Use| Multicolor| 12 Pairs|
- boAt Aavante Raga Plus 140 W Bluetooth Soundbar (Premium Black, 2.2 Channel)
- Acer Titan X Wired Right Handed Optical Gaming Mouse (USB 2.0, Black)
- Mankind PetStar Kitten Cat Food – Salmon Flavour (1 Kg) | Complete & Balanced Nutrition for Healthy Growth, Urinary, Immune & Digestive Support
- Orient Electric Grace Pro 20W LED Batten| 2000 lumens Bright Light Output| LED tubelight for Home| Sleek & Stylish Design| Non-breakable Polycarbonate housing | Pack of 1
- FRONTECH Gaming Mouse Pad | Water Resistant | Anti-Slip Base | Stitched Edges | 232mm x 182mm x 2mm | Red/Black (MSP-0062)
- Oral-B Pro 3 Rechargeable Rotating Electric Toothbrush for Adults, 3 Cleaning Modes with Pressure Sensor, 2 Min Timer with Quadpacer, 2 Year Warranty by Oral B, IPX7 Water Resistant, Round Brush Head
- Clazkit Water Bottle Stainless Steel Sports/Fridge Bottle with Leak Proof Lid | Single Wall | For Home, Office, Gym, Travelling | Lightweight | BPA Free |Set Of 1-750ml | Silver)
- AGARO 5-in-1 Type-C Multi-Port Hub, 4K@30Hz USB-C to HDMI Adapter, 85W PD Charging, 3× USB-A & USB-C 3.0 Data Ports, Compatible with Type-C Devices
- Halonix 5W Portable LED Torch + Bulb 2-In-1 Emergency Hanging Lantern,Rechargeable Emergency Light With Type C Charging,Portable LED Light,4 Hours Battery Backup,Cool Day Light,Pack Of 1,White
- Axe Strong Perfume for Men | Black Cherry Woody Fragrance | 12Hr Long Lasting | Woody Amber Fruity Eucalyptus lavender cherry vanilla amber fragrance| AXE Premium EDP 100ml | Black Cherry
- Halonix 1W Micra Rechargeable Torch with Focus Adjuster | Li-ion Battery | Compact LED Flashlight | Adjustable Beam | Pocket Torch for Women | Ideal for Travel & Home | Pink/Green
- MISTIQUE Ultra Soft 2 Ply Facial Tissue Box | 400 Pulls | 100 Pulls x 4 Boxes | Skin Friendly & Highly Absorbent | Natural Virgin Pulp | Car, Home & Office Use | Sheet Size (17 * 20) cm
- Dubstep Pop 1400 Portable Bluetooth Speaker | 14W Loud Sound, Deep Bass with XBASS, 16 Hrs Playtime, TWS Stereo Pairing, 52mm Driver, Splash-Resistant, Carry Strap (Black)
- Frontech HDMI Extender 30M | Full HD 1080p@60Hz | HDMI Over Cat5e/Cat6 | Plug & Play | No Power Required | Wide Compatibility | 2 Year Warranty (NC-0080)
- Havells 16 A Wi-Fi Smart Plug (White) with Voice Control & Energy Monitoring — Suitable for Large Appliances like Geysers, Heaters, OFRs, and Air Conditioners (Works with Alexa and Google Assistant)
- Halonix PolycarbonateMagnus Desk Light | with 4.9W Led Bulb | B22 Holder | Light Weight | Easy to use Study lamp | Designer Study | with Fixed Head lamp, Beige
- Halonix Joy Rechargeable Desk Lamp with C-Type Charging | LED Study Table Lamp with Step Dimming | Li-ion Battery | Portable Eye-Care Light for Study, Work & Home Use
- Yardley London Cool Wave | Eau De Parfum | Long Lasting International Perfume for Man | Mint Aqua Patchouli Fragrance | Upto 15% dosage | 100ml EDP| Ideal Gift for Man
- Murphy Crest Premium 7W 3-in-1 LED Concealed Down Light |Cool White, Warm White & Natural White | Switch Controlled Color Changing | Modern False Ceiling Lighting | 2-Year Warranty | Pack of 4
- amazon basics HDMI Cable, High Speed, Supports 3D, 4K@60Hz, ARC and CEC Extension, Gold-Plated Connectors, Compatible with TV, Set-Top Box, Gaming Consoles, Blu-Ray (2 Meters)
- POND’S Pure Detox Face Wash 200 g|| Daily Exfoliating & Brightening Cleanser|| Deep Cleans Oily Skin – With Activated Charcoal for Fresh|| Glowing Skin
- HP M190 Wireless Mouse (AB3C6AA)
- STRIDERS Avengers School Bag for Kids – Lightweight, Durable & Stylish Backpack with Padded Comfortable Straps, Spacious Compartments – Marvel Superhero Design for School, Play & Daily Use
- HP KM200 Wireless Mouse and Keyboard Combo, Full-Size Ergonomic Design, 3 Button and Built-in Scroll Wheel, 2.4 GHz Wireless connectio, 3 Years Warranty (7J4G8AA)
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 9th August 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 9th August 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 9th August 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbabydodiedobajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdecathlondistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato