Pages
- Best Laptops Deals August 2026
- Best Smart Watches August 2026
- Mobiles
- Amazon Deals & Offers for August 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 31st August 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Parachute Advansed Soft Touch Body Lotion for Women & Men, All Skin types, 400ml | Pure Coconut Milk & Honey, 100% Natural, 72h Moisturisation
- Corslet 12 Pcs Dual Tip Brush Pens Felt Tip Pen Set 12 Colors, Colouring Pens Art Markers for Kids and Adults, Colouring Book, Art Supplies Fineliner Tip Brush Marker for Drawing Sketching
- Cello Melamine Joycee Mugs – Set of 4, Multicolour, 200ml
- Amazon Basics Nylon Knee Support | Lightweight Knee Sleeve for Men and Women | Stretchable | for Sports, Fitness and Daily Use | Pack of 2 | Black, S
- SignoraWare Mini Double Decker Stainless Steel Lunch Box,(225ml+225ml+450ml, Blue), Dishwasher Safe, Retains Freshness & Quality, Best for Office Executives & Students, Picnics and Outings
- Signoraware Meal Mate Stainless Steel Big Lunch Box with Bag (450mlx3, Red)
- SignoraWare Laguna Vacuum ISI Certified Stainless Steel Bottle,(500ml, Green), Airtight & Leakproof, Retain Freshness For Hours, Ergonomic Design, Ideal for School, Office, Gym Or Outdoors
- AWG ALL WEATHER GEAR Jackets for Men
- SJ Organics Hand Pressure Garden Sprayer Pump | 1.5 Litre Capacity | Adjustable Brass Nozzle (Jet & Mist) | Manual Sprayer for Plants, Gardening, Cleaning & Pest Control (Multicolor)
- HomeWiz Large 2 Tier Plastic Dish Drying Rack | Double Deck Utensil Rack with Cutlery Holder & Drainage | 50 KG + Weight Capacity | Heavy Duty Rust-Free BPA-Free Kitchen Drying Stand | 47 x 29 x 27cm
- HomeWiz Cast Iron Appe Pan 7 Cavity 18 cm | Free Oil Dispenser 500ml | Pre-Seasoned Appe Maker for Appam, Paniyaram & Appe | Non Stick Appam Pan | Naturally Non-Stick | Works On Induction & Gas
- HomeWiz Large Steel Chopping Board for Kitchen – 100% Stainless Steel Cutting Board | Heavy Duty Chopping Board | Non-Porous Hygienic Surface for Vegetables, Meat & Fish, Rust-Resistant | 41 x 31 cm
- PHILIPS Audio TAT1179WT/94 True Wireless in Ear Earbuds with Pocket Sized Charging Case, Play Time Upto 45Hrs, 10mm Dynamic Drivers, Inbuilt Mic, IPX4 Splash & Sweat Resistant (White)
- Lifelong Sleeping Bag for Adults – Winter Sleeping Bags Certified for Temperatures 4°C to 10°C – Mummy Shape Foldable Camping Bed Height Upto 6’5”feet – Travel Accessory for Camping, Hiking, Trekking
- Lifelong ISI Certified Electric Kettle 1.5L with Stainless Steel Body,1500 W Easy and Fast Boiling of Water for Instant Noodles, Soup, Tea etc. (1 Year Manufacturer’s Warranty, Silver, LLEK23)
- Saffola Wild Forest Organic Honey, 500g, Wild Forest Organic Honey
- Saffola Honey Active, 1kg, Made with Forest Honey, Pure Honey, No sugar adulteration, Natural Immunity booster
- Saffola Millet Muesli with Crunchy Flavour Pops & High Fibre | 650g | Fruit Crunch | 81% Fruits, Seeds & More | Power of Millet | Goodness of 5: Protein, Fibre, Vitamins, Iron & Jowar
- Sundrop Heart High Protein Oats| 27g Protein| Zero Added Sugar| Whey Protein Added| 12.6g Fibre| 500g| Chocolate| Added Seeds, Almonds & Raisins
- Silicone Bath Body Scrubber Brush for Men & Women – Soft Silicone Shower Scrubber for Body & Face, Gentle Exfoliating Body Brush with Rich Lather, Deep Cleansing, Massage Nodes & Non-Slip Grip Handle, Pink (1 Pack)
- Story@Home bedsheet for Double Bed Queen Size 240TC Satin Finish, Microfiber Double Bed bedsheet, 225X250cm with 2 Pillow Covers, Purple & Yellow, Motif | Perfect for Festive Gifting
- CELLO Modustore Pet Storage Container For Kitchen Set of 6 Pcs, Blue (1200ml x 3, 600ml x 3) | Freezer & Fridge Safe, See Through Airtight Pet Kitchen Storage Container For Beans, Whole Grains, Spices
- 4 Pack Damp Clean Duster Sponge, Reusable Sponge Baseboards Cleaner Brush, Duster for Cleaning Blinds, Vents, Glass, Railings, Mirrors,Window Track Grooves and Faucets
- Heavy Duty Self Adhesive Wall Hooks | Waterproof PVC Sticky Hooks Stainless Steel Big Hooks for Home Storage Bathroom Kitchen | Silver Multipurpose 10KG Capacity (Golden Hook 10-pcs)
- Polycab Silencio Mini 600mm 5-Star BLDC, Remote Ceiling fan for home | 55% Energy Saving, 100% Copper, High Speed, 25 Speed Setting, Reversable & Timer | 4-yr Warranty【Pearl Beige】
- One94Store 20 Meter (66 Feet) Multicolor Rice Lights (Pack of 2) | Waterproof Copper Wire Decorative String Lights | Diwali Lights for Home, Festival, Puja, Indoor & Outdoor Decor
- Clensta Red Aloe Vera Gel 22X More Powerful Than Normal Aloe Vera For Skin And Hair With 1% Niacinamide & Vitamin E | Hydrating, Moisturizing & Glowing Skin | For Women & Men All Skin Type – 130Ml
- Hydrating Conditioner 900 ml, 72HR Hair Smoothing for Frizz Control,Helps Repair Split Ends, Bouncy Hair Full of Life, Smooth & Silky Hair For Men & Women, Silicone, Sulphate & Paraben free
- Amazon Basics Pro Series 2.4G + Bluetooth + USB Triple Mode Wireless Ergonomic Mouse | 9 Buttons | Adjustable DPI (800–2400) | 500mAh Battery | Type-C Charging | Black
- Parachute Advansed Aloe Vera Enriched Coconut Hair Oil Gold | 5X Aloe Vera With Coconut | Makes Hair Sooperr Soft | 600ml
- Go Vegan Roasted Salted Edamame, 150gm (46% Protein, 17% Fiber, Lightly Salted Young Green Soybeans | 100% Veg Protein Rich Snacks)
- Parachute Advansed Almond enriched Coconut Hair Oil with Vitamin E, 100ml|Nourishes & Softens Hair | Helps Control Hair Fall| Helps Promotes Hair Growth | Up to 2x Softer Hair|Non-Sticky Formula| Dermatologically-Tested Hair Oil | For Men & Women
- Parachute Advansed Protein Shampoo | with Coconut Milk and Aloe Vera | For up to 100% Damage Repair & up to 3X Softer Hair | Protein Lock Technology | Paraben-Free | For Men & Women | 1.2L
- Parachute Advansed Protein Shampoo with Coconut Milk & Rosemary | Up to 96% Hair Fall Reduction & up to 23X Hair Fall Control | Protein Lock Technology | Paraben free | For Men & Women | 1.2L
- Parachute Advansed Gold Vitamin E with Pure Coconut Hair Oil | 475ml| Soft & Smooth Hair | For All Hair Type| No Paraben & Silicones
- Swimming Ring Swim Tube for Kids Swimming Learing Ring for Girls and Boys Swimming Tube Inflatable Swim Ring (20 INCH Pack of 2)
- amazon basics Wired USB Mouse, 3-Button, 1000 DPI Optical Sensor, Plug & Play, for Windows/Mac
- Ant Globe 18 Wired Optical Mouse, USB Type C Computer Mouse with Adjustable 1600 DPI Sensor, Ergonomic Lightweight Corded Office Mouse with 1.2m Cable for Laptop, PC, Desktop,Windows,Mac &Linux, Black
- Hasitam SAFFRON Powder 5Gm, World’s Finest Wonder Spice Saffron (Kesar), Kumkuma Puvva Certified (A++++) Quality Value Pack Kashmiri Kesar Powder Ideal for Sweets, Tilak, Milk, Skin And Face 5gm (Pack of 1)
- Noy Liquid Matte Lipstick Bold Matte Pigment for a Sleek, Chic Look – Creamy Nude, Nude Pink, Red Wine, Venetian Red Shades Pack of 4
- Noy Festival Collection 4 Liquid Matte Lipstick Essentials Cherry Pink, Red, Pruple, Magenta Shades
- Just Herbs Luxe Satin Melt High Shine Lipstick | Luxury Makeup | Ayurvedic Formula | Long Lasting Shine | Ayurvedic Lipstick – 4 gm (06 BERRY ALLURE)
- Relove Lip Kit Swoon (High-Glossy)
- Symbol Women’s Cotton Blend Regular Fit Lounge Shorts (Available in Plus Sizes)
- Plantex Adhesive Shelf for Bathroom/GI Steel Shelf with Minor Surface Marks from Transit, Fully Quality Checked/Bathroom Organiser with Side Hook – Pack of 2 (Black)
- Lumio Arc 5 Portable Home Projector | Official Google TV with Netflix | Native 1080p Full HD | 4K Support | 200 ANSI Lumens | Auto Keystone | Dolby Audio | Sealed Light Engine | Bluetooth Speaker
- Ghangaria Snow Mist Car Perfume 40ml | Press to Diffuse Luxury Fragrance Bottle | Fresh Citrus Floral Aquatic Scent for Car Dashboard & Console | Up to 400 Presses / 133 Days
- Bajaj Rapido 400 mm Table Fan, Pearl Blue, With Full Copper Motor and High Speed Operation, Regular
- HP GK400Y Mechanical Gaming Keyboard/Light Sync Backlit/Auto-Sleep Mode/RGB Colour/Full-Size Mechanical Keyboard
- GAMDIAS Helios P1A 650G | Non Modular Power Supply Unit | 650W 80 Plus Gold | Support C6/C7 Power State, 120mm Hydraulic Bearing Fan, Full-Bridge LLC, Flat Black Cables
- new balance 550 Unisex Casual Sneakers
- Apple iPhone 17 256 GB: 15.93 cm (6.3″) Display with Promotion, A19 Chip, Center Stage Front Camera for Smarter Group Selfies, Improved Scratch Resistance, All-Day Battery Life; White
- Crompton Highspeed Toro 1200 mm Designer Ceiling Fan | BEE Star Rated Energy Efficient | Anti-Dust | Active Power Technology | Upto 50% Less Heating | 2 Year Manufacturer Warranty | Magic Brown
- IFB 9 Kg 5 Star, DeepClean® Technology, AI Powered, WiFi, Fully Automatic Front Load Washing Machine (EXECUTIVE MXN 9014K CMS, PowerSteam®, 9 Swirl, Steam Refresh, Inbuilt Heater, Eco Inverter, Mocha)
- Casio Men MTP-VT03BL-7BDF Analog White Dial Men (A2410)
- Amazon Basics 100% Blackout Roller Blinds for Windows (2 feet x7 feet WXH, Fossil) | Polyester | Manual Roll-Up | UV & Glare Protection | Thermal, Waterproof | for Home & Office
- Aristocrat Enigma 52 Cm Polyester Softsided Cabin Size Duffle Bag – Blue
- HP Campus Core 16 Laptop Backpack – Black
- Boldfit Blaze Football Practise Foot Ball with Pump Training Football Size 5 Original
- Stayfree Dry Max All Night Sanitary Pads – 42 Pads (Pack of 3 × 14) | Ultra‑Absorbent Overnight Protection | Extra Long | Comfortable Fit | Leak‑Lock Technology
- Vector X OGL-161 Women Activewear High Waist Sports Leggings for Girls- Secure fit Tights for Gym, Yoga, Running, Super Stretch, Sweat-Wicking, Lightweight, Breathable|Ankle Length (Charcoal) S
- E-COSMOS® 2-Tier Under Sink Organizer – Pull Out Cabinet Storage with Hooks & Hanging Cup, Multi-Purpose Under Bathroom Sink Organizer and Storage, Kitchen Cabinet Organizer,(Black)
- ARTO Clear Egg Trays for Refrigerator Organization – Stackable Egg Holder & Plastic Storage Container – Durable Dishwasher Safe Egg Carton Replacement – Kitchen & Fridge Organizer (Set of 2)
- Samsung 25W USB Travel Adapter for Cellular Phones – White
- One94Store 3D Engraved Deer Crystal Globe Lamp | USB LED Night Light with Wooden Base | Creative 6 cm Crystal Ball Table Lamp for Bedroom, Home, Office Décor & Gifting (Warm White)
- Marvel Go Collection | Knight Speed | Iron Man | 1:64 Diecast Toy Car | Ages 3 and Up | Collect Them All, Red
- Johnson’s Baby No More Tears Baby Shampoo, 500ml
- Beardo Godfather Perfume for Men | Long Lasting Perfume for Men | Aromatic & Spicy Scent | Gift for Husband, Boyfriend & Men | 20ml
- Dyazo 115-in-1 Precision Screwdriver Set | Professional Wrench Bits Repair Tool Kit with Portable Case for Electronics, Mobile, Laptop, PC, Watch, Game Console & DIY Household Repairs (Black)
- Aristocrat Comet Cabin Polycarbonate Hard Case 8-Wheel Trolley Bag, Brown
- Corslet 43 Pcs Stationery Items – 42Pc Dual Tip Alcohol Markers Pens Set with Two Different Packs of 30pc & 12pc Brush Pen Sketch Pens for Painting Sketching Calligraphy Drawing Marker Pen with Pad
- atomberg Studio Exhaust Fan 150mm (6 Inches) | BLDC Motor | 6.8W| Low Noise | 2000 RPM| Ideal for Bathroom,Kitchen | Easy to Clean | Installation-Round Cut (153mm) | 2 Years Warranty | (Gloss Black)
- Cutting EDGE Microfiber Dish Drying Mat – Water Absorbent & Reversible for Kitchen Utensils, Counter Top, Sink (Pack of 2, Grey Color, Combo)
- Bella Vita Luxury Unisex | Long Lasting Eau De Parfum Gift Set 4 x 20ml Perfume for Unisex | with SKAI, FRESH, WHITEOUD, HONEY OUD | Premium Fragrance Scent
- HAMMER Aura ANC Earbuds Wireless, 32dB ANC Ear Buds with ENC, Low Latency Gaming Earbuds with 35ms Mode, 50H Playtime, 13mm Titanium Driver, Transparency Mode, IPX4, Bluetooth 6.0, Beige
- TEX-RO Air Tight Containers For Kitchen Storage Box/BPA Free Storage Containers For Kitchen/Containers For Kitchen Storage Set/Kitchen Accessories Items For Home (Black, 500 Ml set Of 6)
- YOUVA Navneet Youva | Soft Bound | Brown Note Book | 18X24 Cm | Single Line | 92 Pages | Pack Of 6
- Royal Silky Kitchen Tissue Rolls – 240 Pulls | 60 Kitchen Towels X 4 Rolls| 2-Ply Soft & Strong Kitchen Paper Towel | Highly Absorbent Disposable Kitchen Tissue | 2 rolls x Pack of 2
- Reebok Mens Persona Wanderer Sneaker
- realme Buds Air 8,11mm+6mm Dual Dynamic Bass Drivers,58Hrs Playtime, 55dB ANC,6 Mic ENC, 45ms Low Latency, 360° Spatial Audio, Hi-Res LHDC, IP55 Dust & Water Resistant, BT V5.4 (Master Grey)
- ASUS Vivobook 16, Snapdragon X, 16GB RAM, 512GB SSD, FHD+ 16″, Windows 11, Office Home 2024, Quiet Blue, 1.88kg, X1607QA-MB049WS, Qualcomm Adreno iGPU, 45TOPS, M365 Basic (1Year)* Laptop
- Microfiber Cleaning Cloth, 30×40 cms 600 GSM | Highly Absorbent,Lint and Streak Free, Multi-Purpose Wash Cloth for Kitchen,Car,Window,Stainless Steel,Silverwear (Yellow_30x40cms) Pack of 3
- Microfiber Cleaning Cloth, 30×40 cms 600 GSM | Highly Absorbent,Lint and Streak Free, Multi-Purpose Wash Cloth for Kitchen,Car,Window,Stainless Steel,Silverwear (Pink_30x40cms) Pack of 3
- Orient Electric Apex Swift 1200mm BLDC Ceiling Fan with Remote | BEE 5 Star Rated | High Speed, Energy Saving Motor | 210 CMM Air Delivery | Inverter Compatible | 3 Year Warranty by Orient |Clay Brown
- Ai+ Pulse 2 (Black, 64 GB) (4 GB RAM)
- Milton Prudent 500 Thermosteel Bottle, 510 ml Water Bottle, 24 Hours Hot and Cold, Double Wall Vacuum Insulated, Water Bottles, Tea Flask/Coffee Flask for Sports, Travel, Red
- Philips SceneSwitch 12W LED Bulb | 3-in-1 Light Modes CDL-NW-WW | B22 Base | Change Brightness with Wall Switch | Energy Efficient | Pack of 1
- CELLO Aluminium Nonstick 12 Cavity Appam Patra Chatty Pan Maker with Steel Lid, Black | Double Hand Handle, Gas Stove Compatible Mini Uttappa Paniyarakkal Cup Cake Frying Pan Kadhai for Kitchen
- CELLO Bella Lunch Box with Bag for Office Use, Maroon | 225ml, 375ml, 550ml Microwave & Oven Safe Containers with 500ml Tumbler, Airtight Snap Lock Leak Proof Insulated Tiffin Box for College & Travel
- CELLO Clario Pet Storage Container for Kitchen Set of 24 Pcs Black | 8x300ml, 8x650ml, 8x1200ml Freezer & Fridge Safe Stackable Airtight Kitchen Storage Container Jar Set for Candy Beans Flour Pastry
- Bagsymalone Unisex’s Modern (Sea Green)
- Bagsy Malone Bucket Shaped Tote Bag -Set of 2 | Handcrafted Side Tote Bag for Office and College (Croco Brown)
- BUTRUKIDS Girls
- Nutberry Peanut Butter Creamy 510gm in Bucket 500 g
- Oatmeal Dog Shampoo 200ml + Tick & Flea Dog Shampoo 200ml + WoofMist Pet Perfume Spray 100ml Combo | Tea Tree Lemon Aloe Soothing Moisturizing & Anti Tick Cleansing | Grooming Kit
- Dog Grooming Combo Tick & Flea Shampoo 200ml + Oatmeal Shampoon 200ml with Deshedding Glove | Anti Tick Cleansing Moisturizing Bath Care Kit for Dogs | Fur Removal Massage Glove Grooming
- Body Part Puzzle Kids Wooden Toys For Kids 3 + Jigsaw Puzzles
- Acer USB Hub for Laptops 4-in-1, Multi USB 3.0 Port Hub Extension Adapter, Type A Splitter Extender for Keyboard, Mouse, Compatible with acer PC, XPS, Surface, ThinkPad – 2FT/60cm
- STUDDS Raider Street ISI Certified Full Face Helmet for Men and Women with Clear Visor (Green – L)
- Tygot 10 Inches Big LED Ring Light for Camera, Phone, tiktok, YouTube, Video Shooting and Makeup, 10″ inch Ring Light with 7 Feet Long Foldable and Lightweight Tripod Stand
- Havells Glaze 1250 Watts Steam Iron with Self Cleaning Function|Vertical & Horizontal Ironing|170 ml Tank for Longer Ironing|High Steaming Rate Upto 12 gm/min|2 Years Door Step Warranty by Havells
- ASUS TUF Gaming X670E-PLUS WiFi AMD Ryzen™ AM5 ATX Motherboard, 16 Power Stages, PCIe® 5.0, DDR5 Memory, Four M.2 Slots, WiFi 6E and 2.5 Gb Ethernet, USB 4 Header and Aura Sync
- RR Signature Centaur 400 mm Table Fan (2 Year Warranty)
- Clazkit 50 Pack, 4-Compartment Disposable Meal Tray | Compostable Bagasse Plates | Eco-Friendly Biodegradable Dinner Plates | Party, Wedding, Event Plates, White
- MICHELIN iFit Premium Faux Leather Steering Wheel Cover- Black Fur Stich, DIY – No Tools Required to fit, iFit Technology Stretches to fit 14.5″ & 15.5″ Inches Most Steering Wheels
- Cello Eliza Laundry Basket with Lid (50 L) | Lightweight, Portable Plastic Storage Organizer for Clothes, Toys, Books | Multipurpose Hamper Bin | Light Grey
- Vicco Turmeric Sandal Bathing Bar I Refreshing Body Soap IS De Tan, Brighten And Restores The Natural Glow I Suitable For All Skin Types Each 100 Gm I Pack Of 2
- Scalpe Pro Daily Anti-Dandruff Shampoo | Removes Dandruff from Source | Prevents Itching & Irritation | Scalpe Science | Climbazole Formulation | Dermatologically Tested | For Women & Men | 650ml
- Braun MultiQuick 1, Powerful 450W Hand Blender, Made in Europe, EasyTwist Technology, Lightweight, Stainless Steel German Design, Dishwasher Safe, Make Baby Food, Chutney, Smoothie, Soup, MQ10.000P
- Samsung Crystal 4K Vision AI 108 cm (43 inch) Ultra HD (4K) LED Smart Tizen TV 2026 Edition with 30W Speakers 4K
- Kingston 128GB Canvas Select Plus microSD Card | Read Up to 150MB/s | V10 A1 UHS-I | with SD Adapter | SDCS3/128GB
- Sleepyhead RX5 Designed by Duroflex – Single Seater Fabric Manual Recliner with Durable Spring Support | Stylish Upholstery | Snug Fit for Luxurious Comfort (Cocoa Brown)
- Apple iPhone Air 256 GB: Thinnest iPhone Ever, 16.63 cm (6.5″) Display with Promotion up to 120Hz, Powerful A19 Pro Chip, Center Stage Front Camera, All-Day Battery Life; Cloud White
- Kingston DataTraveler SE9 G3 256GB USB Flash Drive | USB 3.2 Gen 1 Speed | Up to 220MB/s | Premium Metal Casing | DTSE9G3/256GB
- POCO M8x 5G (Leather Green, 128 GB) (6 GB RAM)
- ASUS Vivobook Go 15, AMD Ryzen 5 7520U Thin & Light Laptop(AMD Radeon iGPU/8GB RAM/512GB SSD/FHD/15.6″/60Hz/Windows 11/M365 Basic (1Year)*/Office Home 2024/Mixed Black/1.63 Kg) E1504FA-NJ133WS
- MOTOROLA g37 power (PANTONE Impenetrable, 128 GB) (4 GB RAM)
- Inalsa 450 W Black Hand Blender
- Youva Regular 1 ruled/1 graph 22cm x 28cm 68 gsm Graph Paper
- Milton Prudent 500 Thermosteel Bottle, 510 ml Water Bottle, 24 Hours Hot and Cold, Double Wall Vacuum Insulated, Water Bottles, Tea Flask/Coffee Flask for Sports, Travel, Aqua Green
- CELLO Duet Set of 4 Pcs Stainless Steel Lunch Box with Bag for Office Use, Black | 2 x 400ml Round, 2 x 400ml Square Steel Containers with Fork & Spoon, Leak Proof Airtight Steel Tiffin Box for Travel
- Nivia Combo Storm 2.0 Football (Size – 5, Yellow) with Ball Pump
- Set Wet Styling Hair Gel for Men – Sport Extreme, 250gm | Extreme Hold, High Shine |For Short to Medium Hair| No Alcohol, No Sulphate
- Samsung Galaxy Buds Core (Black) Galaxy AI Enabled in-Ear TWS with ANC | Enriched Bass | 6 Mic Setup | IP54 | 35hrs Battery | Touch Controls
- 3D METRO SUPER STORE Gamma with 360° Spinner 2 Microfiber heads &…more
- Reynolds Aeroslim Ball Pen (Pack of 70, Ink Color – Blue, Black, …more
- GIGABYTE Z890 AORUS PRO ICE Intel Core Ultra (Series 2) LGA 1851 Motherboard, ATX, DDR5, 5X M.2, PCIe 5.0, Thunderbolt 4, WIFI7, 5GbE LAN, EZ-Latch
- MSI B760M Project Zero, Back-Connect Micro-ATX – Supports 14th/13th/12th Gen Intel Core Processors, LGA 1700-75A DrMOS VRM, DDR5 Memory Boost 7800+MHz/OC, PCIe 5.0 x16, 2 x M.2 Gen4, Intel Wi-Fi 6E
- Cetaphil Optimal Hydration Restoring Water Gel 48 g – Lightweight 72H Weightless Hydrating Gel for Dry & Sensitive Skin | Daily Moisturisation Hydro Boost & Skin Refreshing Formula
- IONIX Weight Machine for Luggage, Wait Machine, Luggage Wighing Scale, Digital Weighing Scale, Bag Weighing Scale for Luggage, Electronic Portable Fishing Hook Type Digital LED Screen, 50 kg (Black)
- Fiama Gel Bar Patchouli & Macadamia 375g (125g Pack of 3) | Soft Glowing Skin | Skin Friendly pH | Moisture Lock with 30% Smoothing Body Serum | Bathing Soap for Women & Men | All Skin Types
- DeoDap Designer Murli Flute Rakhi for Brother with Choco Coated Nut Butterscotch Chocolate 96gm, Pooja Coin, Roli Chawal & Card | Rakhi with Chocolate Combo for Raksha Bandhan
- STRIFF 4-in-1 USB Hub Multiport Adapter | Aluminium Shell Design | 1× USB 3.0 & 3× USB 2.0 Ports | High Speed Data Transfer | Compact Expansion Hub for PC/Laptops, Tablets & Mobile Phones
- BELLAVITA Date & Glam Women Long Lasting | Perfume for Woman | Gifts for Woman | EDP 2x20ml | Floral, Fruity, Citrusy & Woody Premium Fragrance
- Fiama Gel Bar Mega Celebration Pack 1kg (125g Pack of 8) | 8 Unique Soap Variants | Moisturised Skin with 30% Smoothing Body Serum | Bathing Soap Gift Set for Women & Men | All Skin Types
- Go24 pexpo Bistro Pro ISI Certified Stainless Steel Fridge/Sports Water Bottle 750ml, Silver | Single Wall | Leakproof Water Bottle for Home, Office, Gym, School
- CELLO Aluminium Nonstick 12 Cavity Appam Patra Pan Maker with Steel Lid, Black | 2 Side Riveted Handle, Gas Stove Compatible Die-Cast Mini Uttappa Paniyarakkal Cup Cake Frying Pan Kadhai for Kitchen
- insta360 X4 Motorcycle Bundle- 8K Waterproof 360 Action Digital Camera, 4K Wide-Angle Video, Removable Lens Guards, 135 Min Battery Life, Ai Editing, Stabilization, for Sports, Travel,Black
- CELLO Athlete Water Bottles Set of 4 Pcs For Daily Use, 800 ml Each Multicolor | Stylish & Unbreakable BPA-Free Leakproof Refrigerator Safe Flip Top Lid Water Bottle For School, Office & Travel
- INGCO Air blow gun
- Arokleen Baby Gentle Wet Wipes with Lid | 432 Wipes – Pack of 6 | Enriched with Aloe Vera & Vitamin E | pH Balanced | Dermatologically Tested | Paraben & Sulphate Free | Prevents Rashes & Redness | Gentle Moisturising Wipes
- Centrino Walking Shoes for Men | Sneakers for Man Stylish | Casual Lightweight Lace-Up with Cushioned Insole | Breathable Comfortable Canvas Shoes | Anti-Skid Sole | Mens Sneaker Shoes for Daily Use (6311)
- Symbol Women Rayon Fit and Flare One Piece Knee Length Tiered Dress (Available in Plus Sizes)
- Colors Queen Film Studio Makeup Cover foundation with SPF-30 | Lightweight Texture, Long Lasting Waterproof | Full Coverage, Hypoallergenic Matte Finish Foundation for Face Makeup (208)
- POPWINGS Casual Printed Top and Joggers Set for Women || Stylish Summer Co-Ords Set for Women || Round-Neck Top and Joggers Combo Set for Women
- Foodie Puppies Interactive Feather Teaser Cat Toy, Mouse Play Stick, Suction Cup Base, Flexible Self-Play Wand, Indoor Exercise & Hunting Instinct Stimulation
- DMAK Multi Traders 6W (3+3) Led Side PGB(Pink,Green,Blue) Round Conceal Panel Light, Pack of 4
- NIVEA Lemon and oil 500ml Body Wash| Shower Gel with Scent of Lemon and Care Oil | Pure Glycerin for Instant Soft & Summer Fresh Skin|Microplastic Free |Clean, Healthy & Moisturized Skin
- Eliane Handheld Car Vacuum Cleaner 16000Pa, 120W Cordless Mini Vacuum & Air Duster, 84000RPM, 4000mAh Battery, 30 Min Runtime, Type-C Charging, LED Light, Multi-Nozzle for Car, Home & Office
- ViewSonic VX2779A-HD-PRO 27 inch (68.5 cm) FHD IPS Gaming Monitor | 240Hz | 1ms MPRT | HDR10 | AMD FreeSync Premium | SuperClear IPS | Eye Care | HDMI, DisplayPort | Ultra Slim Frameless Design
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Who was the top scorer for India in the T20 World Cup final 2024?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- By what Indian name is the Indian roller bird commonly known
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Father’s Day Special Quiz Answers -Play and Win
- Amazon Funzone FIFA fever quiz and spin
- IIT Delhi is going to set up its first Global Campus in which country?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- National Rifle Association of India is associated with which sport?
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- What is the name of the mascot of the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Achanta Sharath Kamal represents India in which sport?
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Who became the 17th Indian to score a century in Test debut?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 31st August 2026
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 31st August 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 31st August 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbabydodiedobajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdecathlondistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusoppoottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato